KEGG   Methylobacterium aquaticum: Maq22A_c21460Help
Entry
Maq22A_c21460     CDS       T04311                                 

Definition
(GenBank) malonic semialdehyde reductase
  KO
K05886  serine 3-dehydrogenase (NADP+) [EC:1.1.1.276]
Organism
maqu  Methylobacterium aquaticum
Brite
KEGG Orthology (KO) [BR:maqu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Maq22A_c21460
Enzymes [BR:maqu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.276  serine 3-dehydrogenase (NADP+)
     Maq22A_c21460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Sacchrp_dh_NADP Epimerase NAD_binding_10 EccE
Motif
Other DBs
NCBI-ProteinID: BAQ47311
UniProt: A0A0C6F3W1
Position
4169811..4170572
Genome map
AA seq 253 aa AA seqDB search
MSKIALVTGATAGFGDAIARRLARDGWRVVVTGRRRDRLDALVAALGGSERAHPLAFDIR
DEAATRDALASLPPAFAEVSLLVNNAGLALGTGPAQESDLAQWRTMIDTNVVGLVTITRL
LLDRLIAHRGLVVNLASIASHWPYPGGNVYGGTKAFVRQFSLGLRCDLSAKGVRVTSIEP
GLSESEFTLVRTGGDQAASDALYKGAHPLRPEDIAETVGWVASLPPHVNVNSLEIMPVTQ
SWAPFAIQRDPAA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagatcgccctcgtcaccggagccaccgcgggcttcggcgacgccatcgcccgc
cggctcgcccgcgacggctggcgcgtcgtggtgaccgggcgccgccgcgaccggctcgac
gccctggtggcggcgctcggcggcagcgagcgcgcccatccgctcgccttcgacatccgc
gacgaggcggcgacccgggacgcgctcgcgtcgctgccgccggccttcgcggaggtctcg
ctcctcgtcaacaatgcggggctggcgctcggcaccgggccggcgcaggagagcgacctc
gcccagtggcggacgatgatcgacaccaacgtcgtcggcctcgtcacgatcactcggctc
ctgctcgaccggctgatcgcccatcgcggcctcgtcgtgaacctcgcctcgatcgcctcc
cactggccctatccgggcggcaacgtctacggcgggaccaaggccttcgtccggcagttc
tcgctggggctgcgctgcgacctgtcggccaagggcgtgagggtcacctcgatcgagccc
ggcctgtccgagagcgagttcacgctggtgcgcaccggcggcgaccaggcggcctccgac
gccctctacaagggcgcgcacccgctccggcccgaggacatcgccgagaccgtcggctgg
gtcgcctcgctgccgccccacgtcaacgtcaacagcctggagatcatgccggtgacccag
tcctgggcccccttcgcgatccagcgcgacccggcggcctga

DBGET integrated database retrieval system