KEGG   Methylobacterium aquaticum: Maq22A_c21635Help
Entry
Maq22A_c21635     CDS       T04311                                 

Gene name
hmg1
Definition
(GenBank) 3-hydroxy-3-methylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
maqu  Methylobacterium aquaticum
Pathway
maqu00900  Terpenoid backbone biosynthesis
maqu01110  Biosynthesis of secondary metabolites
maqu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:maqu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Maq22A_c21635 (hmg1)
Enzymes [BR:maqu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     Maq22A_c21635 (hmg1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: BAQ47341
UniProt: A0A0C6F3X8
Position
4205199..4206479
Genome map
AA seq 426 aa AA seqDB search
MQTTSRANRTSRIAGFHTKSPRERLDLVAAFADLSGPEVAHLTEFGNLAPDLADRLIENV
VGTMNVPVGIATNMKIDGEDVLIPMATEESSVVAAVCNAARQVYEDGFTTSVSGNLMIAQ
VQVVGVSDPYAARLRILEQREALRALCDACDPVLVRLGGGLRDVEVRVLDTLGGPMVVTH
LIVDTRDAMGANAVNTMAEAVAPHIAGWSGGRVYLRILSNLADRRLARAHAVWRTDAIGG
PEVRDGIVSAYHLAEADPYRAATHNKGIMNGIDAVVLATGNDTRAIEAGAHAYAARSGRY
TSLTRYEVTASGDLSASIELPLAVGLVGGATKLHPTAQACLKILGATTAERLARIIAAVG
LAQNFSALKALATTGIQKGHMALHAQNIAMMAGALGEEIEAVARVLVERRLVRLDVAQEV
LGEMRR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccacgtcccgggcgaaccgcacctcgcgcatcgccggcttccacaccaagagc
ccccgcgagcgcctcgacctcgtggccgccttcgccgacctgtccgggccggaggtcgcc
catctcaccgagttcggcaacctcgcccccgacctcgccgaccggctgatcgagaacgtc
gtcggcacgatgaacgtccccgtcggcatcgccaccaacatgaagatcgacggcgaggac
gtgctgatcccgatggcgaccgaggaatcctcggtggtggccgcggtctgcaacgccgcg
cgccaggtctacgaggacggcttcaccacctcggtctccggcaacctgatgatcgcgcag
gtgcaggtcgtcggggtgagcgacccctacgcggcccgcctgcgcatcctggagcagcgc
gaggccctgcgcgccctgtgcgatgcctgcgatcccgtgctggtgcgcctcggcggcggc
ctgcgcgacgtcgaggtgcgggtgctcgacacgttgggcggcccgatggtggtgacccac
ctcatcgtcgacacccgcgacgccatgggggcgaacgccgtcaacaccatggcggaggcg
gtggccccccatatcgccggctggagcggcggccgggtctacctgcgcatcctctcgaac
ctcgccgaccggcgcctcgcccgggcgcacgcggtctggcgcaccgacgcgatcggcggg
ccggaggtgcgcgacggcatcgtcagcgcctaccacctcgccgaggccgacccctaccgg
gcggcgacccacaacaagggcatcatgaacggcatcgacgccgtggtgctcgccaccggc
aacgacacccgggcgatcgaggccggggcgcatgcctacgccgcccgctcgggccgctac
accagcctgacccgctacgaggtcacggcgtccggcgacctcagcgcctcgatcgagctg
ccgctggcggtgggcctcgtcggcggggcgacgaagctccacccgaccgcccaggcctgc
ctgaagatcctcggggcgacgaccgccgagcgcctggcccggatcatcgccgcggtgggc
ctggcccagaacttctccgccctcaaggcgctcgccaccacgggcatccagaagggccac
atggcgctccacgcccagaacatcgccatgatggcgggcgcgctcggcgaggagatcgag
gcggtcgcccgcgtgctggtcgagcggcgcctggtgcgcctcgacgtggcgcaggaggtc
ctgggggagatgcggcggtga

DBGET integrated database retrieval system