KEGG   Methylobacterium aquaticum: Maq22A_c26490Help
Entry
Maq22A_c26490     CDS       T04311                                 

Gene name
wcaG
Definition
(GenBank) epimerase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
maqu  Methylobacterium aquaticum
Pathway
maqu00053  Ascorbate and aldarate metabolism
maqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    Maq22A_c26490 (wcaG)
Enzymes [BR:maqu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     Maq22A_c26490 (wcaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd NAD_binding_10 RmlD_sub_bind 3Beta_HSD NAD_binding_4 Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: BAQ48162
UniProt: A0A0C6FLZ1
Position
complement(5112605..5113438)
Genome map
AA seq 277 aa AA seqDB search
MGEATGMRVALSGAGGQIGAVLRPRLLAAGIVLRSGGGPTALTPLSEAETVTTGDLRDAD
AVDRLLEGTEVLVHMAGTSVEKPLPEVIENNLVALHAIYEGARRHALRRVVFASSNHAFG
MHSVESRLDPDAPFRPDGAYGLSKAWGEMMGRMYWDRHGIEGVALRIGSALPRPTEFRHL
STWLGHDDLAQLVLRSIAAPVPGYVAVWGASDNPRSYWNNADAAAAIGYRPTQSAEDWAE
EILAQENPLDPIARTLQGGSFTTMDYTPQAGRPKRGT
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaggcaacggggatgcgggtcgcgctgtcgggagcgggcgggcagatcggggcg
gtgctgcggccgcggctcctcgcggccgggatcgtcctgcgctccggcggcgggccgacg
gcgctgacgccgctctcggaggccgagacggtgacgaccggcgacctgcgcgacgccgat
gccgtcgaccggctgctcgaaggcaccgaggtcctggtccacatggccggcaccagcgtc
gagaagcctctgccggaggtgatcgagaacaacctcgtcgcgctgcacgcgatctacgaa
ggggcgcggcgccacgccttgcgccgggtggtgttcgccagttccaaccacgccttcggg
atgcactcggtggagtcgcgcctcgatcccgacgcgccgttccggcccgacggcgcctac
ggcctgagcaaggcctggggcgagatgatgggccggatgtactgggaccgccacggcatc
gagggggtggcgctgcgcatcggcagcgccctgccgcggccgacggagttccgccacctc
tcgacctggctcggccacgacgacctcgcccagctcgtcctgcgcagcatcgcggcgccg
gtgcccggctacgtcgcggtctggggcgcctcggacaacccgcgcagctactggaacaac
gcggacgccgccgcggcgatcggctaccgcccgacccagtcggcggaggactgggccgag
gagatcctggcgcaggagaaccccctcgacccgatcgcccgcaccctccagggcggcagc
ttcacgacgatggactacacgccgcaggccgggcggccgaagcgaggcacttag

DBGET integrated database retrieval system