KEGG   Methylobacterium aquaticum: Maq22A_c27365Help
Entry
Maq22A_c27365     CDS       T04311                                 

Gene name
thiJ
Definition
(GenBank) AraC family transcriptional regulator
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
maqu  Methylobacterium aquaticum
Pathway
maqu00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:maqu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Maq22A_c27365 (thiJ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:maqu01002]
    Maq22A_c27365 (thiJ)
Enzymes [BR:maqu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     Maq22A_c27365 (thiJ)
Peptidases [BR:maqu01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   Maq22A_c27365 (thiJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: BAQ48305
UniProt: A0A0C6FY88
Position
complement(5282621..5283289)
Genome map
AA seq 222 aa AA seqDB search
MSLSFGILVFPQVQQLDLTGPYEVFASVPDSAVHLIWKDGEPVRSATGIPFVPTATFETC
PPLDVLCIPGGAGVNPLLEDEAVLDFVRARAREVRYLTSVCTGALVLGAAGLLKGRRATT
HWYAHDFLARFGAVPVQDRVVRDGTLITAGGVTSGIDFGLAVVAELLGREEAETVQLTLE
YAPAPPFGAGTPAEAPPAVLERARKRLCGSRAAREAIIGRIT
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgctcagcttcggaatcctcgtcttcccgcaggtccagcagctcgacctgaccggg
ccctacgaggtcttcgcctcggtgcccgacagcgccgtccacctgatctggaaggacggc
gagccggtgcgctcggccaccggcatcccgttcgtgccgaccgcgaccttcgagacctgt
ccgcccctcgacgtgctctgcatcccgggcggggccggggtgaatccgctcctcgaggac
gaggcggtgctggatttcgtgcgtgcccgcgcccgcgaggtccgctacctcacctcggtc
tgcaccggcgcgctggtgctcggcgcggccgggctgctgaagggcaggcgcgcgacgacc
cactggtacgcgcacgacttcctcgcccgcttcggcgccgtgccggtgcaggaccgggtg
gtgcgggacggcaccctgatcaccgccgggggcgtgacctcgggcatcgatttcgggctc
gcggtggtggccgaactgctcggccgcgaggaggccgagacggtgcagctcacgctcgaa
tacgcgccggccccgcccttcggcgccggcaccccggcggaggcgccccccgcggtgctg
gagcgggcgaggaagcgcctctgcggctcccgggcggcccgggaggcgatcatcggccgg
atcacctga

DBGET integrated database retrieval system