KEGG   Microcystis aeruginosa: MAE_06780Help
Entry
MAE_06780         CDS       T00647                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
mar  Microcystis aeruginosa
Pathway
mar00790  Folate biosynthesis
mar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mar00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MAE_06780 (folP)
Enzymes [BR:mar01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     MAE_06780 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: BAG00500
CYORF: MAE_06780
UniProt: B0JPI9
Position
complement(595785..596627)
Genome map
AA seq 280 aa AA seqDB search
MSSLTAIREHIFAWGKRTYIMGVLNVTPDSFSDGGEFDNVENALLQAMKMIEAGADIIDI
GGQSSRPGAEEISLEAELSRVIPVITAIRQQSSIPISLDTTRAIVAAQGIAAGADLINDI
SGGTFDRLLLPTVAKLAVPIILMHLRGNPQTMQSITHYDDLVKEIKEFLQNRVKEALQWG
IARENIIIDPGIGFAKTGTQNLELLRELGQFRDLDLPILIGLSRKRFIGEITGKDDPKER
VFGTAAACALAIAKGADILRVHDVAAIVDVSKVVDAIERS
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtttaacggcaattcgtgaacatatttttgcttggggaaaacgcacctatatc
atgggtgttttaaacgttactcccgatagttttagtgatgggggagaatttgacaatgtt
gaaaatgccctgctacaggcgatgaaaatgatcgaggccggggctgatataatcgatatc
ggtggtcaatccagccgtccgggagccgaagaaattagcctagaagcagaattatcgcga
gttatccccgtaatcaccgctattcgacaacaaagttctattcctatctctctcgatact
acccgggcgatcgtggcagcccaaggtatcgccgccggggccgatttgatcaatgatatt
tctgggggaaccttcgatcgcctattattgcccacggtggctaaattggccgttcccatc
atcctcatgcacctgcggggcaatccgcaaacgatgcaatccataacacattatgatgat
ttagtcaaggaaattaaagaatttttacagaatcgcgttaaggaagctttacagtggggc
attgctagggaaaatattatcatcgatccggggattggtttcgccaaaactgggacacaa
aatcttgagttattgcgagaattagggcaatttcgggatttagatttacctattttaatt
ggattgtcgagaaaacgctttatcggcgagattacaggcaaagatgacccaaaagaacga
gttttcggaacggcggcggcctgtgctttagcgatcgctaagggggccgatatcctgcgc
gtccatgatgtggctgcgatcgtagatgtgagtaaagtggtggacgcaatcgagcgaagt
tga

DBGET integrated database retrieval system