KEGG   Microcystis aeruginosa: MAE_10920Help
Entry
MAE_10920         CDS       T00647                                 

Gene name
rfbC
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mar  Microcystis aeruginosa
Pathway
mar00521  Streptomycin biosynthesis
mar00523  Polyketide sugar unit biosynthesis
mar01130  Biosynthesis of antibiotics
Module
mar_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:mar00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    MAE_10920 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MAE_10920 (rfbC)
Enzymes [BR:mar01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     MAE_10920 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom Cupin_1 Cupin_2 Ycf4
Motif
Other DBs
NCBI-ProteinID: BAG00914
CYORF: MAE_10920
UniProt: B0JS14
Position
938688..939230
Genome map
AA seq 180 aa AA seqDB search
MKITETRIPKCYEIVPTILEDKRGRFVKTLHQDIYKSHQLIINFAEEYYSVSKKNVLRGL
HFQVPPQDCTKIVYCLEGSVMDVVVDLRKGSPTYGEFELFNLSSENGKIIYIPSGLAHGF
YVTSETAIMCYKVSTVYSPKEDTGILWNSVVIPWPNLHPILSERDQSFLPFSEFRSPLVY
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcactgagacaaggattcctaagtgctacgaaattgtccccactattttagaa
gacaagcgtggtcgttttgttaaaactctacatcaggacatctataaaagtcaccagtta
attattaactttgctgaagaatattactcggtgtccaagaaaaatgttttgagaggacta
catttccaagttcctccgcaagattgcacaaaaattgtgtattgtctcgaagggtcggta
atggatgtagtggtagatttgcgtaaaggctcgccaacctatggcgagtttgagttgttt
aatctgagttctgaaaatggtaagataatctatatcccttctggcctagcgcatggtttt
tatgttaccagcgaaacggcaattatgtgctataaagtatcaacagtatattctcccaaa
gaagatacaggaattctttggaattccgtagtaataccttggccaaatctacatcctatc
ttatctgaacgagatcagagttttcttcctttttcagaatttcggagtccgttggtttat
tga

DBGET integrated database retrieval system