KEGG   Microcystis aeruginosa: MAE_20980Help
Entry
MAE_20980         CDS       T00647                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mar  Microcystis aeruginosa
Pathway
mar00260  Glycine, serine and threonine metabolism
mar00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mar01100  Metabolic pathways
mar01110  Biosynthesis of secondary metabolites
mar01130  Biosynthesis of antibiotics
mar01230  Biosynthesis of amino acids
Module
mar_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mar00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MAE_20980 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MAE_20980 (trpA)
Enzymes [BR:mar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MAE_20980 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth ThiG PcrB Ribul_P_3_epim NanE
Motif
Other DBs
NCBI-ProteinID: BAG01920
CYORF: MAE_20980
UniProt: B0JXU3
Position
complement(1872054..1872848)
Genome map
AA seq 264 aa AA seqDB search
MTAVTECFRSLRSQGNCALIPFITAGDPDLSTTAQALRILDRAGADLIELGVPYSDPLAD
GPVIQSAATRALNRGVKLEDVLEIVKNAQGEVKAPIILFTYYNPIYHRGIDVFLDQIKAA
GVSGLVVPDLPLEEAESLLQPAAAKGIEVILLVAPTSPPERIQAIALQSQGFIYLVSVTG
VTGMRKQVATRVEELLDSIRSVTDKPVGVGFGISEPTQALQVKNWGADAVIVGSAMVKRL
ADNSPSDGLKSLEEFCRSLKQAIQ
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgttaccgagtgttttcgttctctccgttcccaggggaattgtgccttaatt
ccctttattactgccggtgatcccgatttgtccactactgcccaagctttacgcatttta
gaccgggcaggggccgatctgatcgagttgggggttccctattccgatcctcttgcggat
ggtccggttattcaatcggcggccacgcgcgctttaaatcggggtgtcaagttggaagat
gtgctagaaatcgtcaaaaatgctcagggagaggtgaaagctcccattattctctttact
tactataatcccatctatcatcgcgggatagatgtctttttagaccaaataaaagcggcc
ggggtgagtggtttggtggttcccgatttacccctagaggaagcggaaagtctgctgcaa
ccggctgccgctaagggaattgaagtgattttattggtagcgcctaccagtcccccggaa
cgaatacaagcgatcgccctgcaatcccaaggttttatttatctggtgagtgtcacggga
gtgacgggaatgcggaagcaagtggccaccagagtggaggaattgctcgattctatccgt
tctgtcaccgataaacccgtgggggtaggatttggcatttctgagccgacacaggcgcta
caggtgaaaaactggggtgctgatgcggtaattgtgggcagtgccatggttaaacgttta
gccgataattcccccagcgatgggttaaaatccctcgaagaattctgtcgcagtttaaaa
caggcgattcagtaa

DBGET integrated database retrieval system