KEGG   Microcystis aeruginosa: MAE_38680Help
Entry
MAE_38680         CDS       T00647                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
mar  Microcystis aeruginosa
Pathway
mar00860  Porphyrin and chlorophyll metabolism
mar01100  Metabolic pathways
mar01110  Biosynthesis of secondary metabolites
mar01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mar00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MAE_38680 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mar01007]
    MAE_38680 (hemL)
Enzymes [BR:mar01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     MAE_38680 (hemL)
Amino acid related enzymes [BR:mar01007]
 Aminotransferase (transaminase)
  Class III
   MAE_38680 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: BAG03690
CYORF: MAE_38680
UniProt: B0JPW6
Position
3543292..3544593
Genome map
AA seq 433 aa AA seqDB search
MVSTSSYQTTKSKEIFTAAQKLMPGGVSSPVRAFKSVGGQPIVFESVKGAYIRDVDGNEY
IDYVGTWGPAICGHAHPEVIAALHDALDKGTSFGAPCVQENILAEMVIDAVPSIEMVRFV
NSGTEACMSVLRLMRAFTGRDKIIKFEGCYHGHADMFLVKAGSGVATLGLPDSPGVPKTT
TNNTLTAPYNDLEAVKALFVENPDSIAGVILEPVVGNAGFIVPDAGFLEGLRELTKEYGA
LLMFDEVMTGFRIAYGGAQEKFGITPDLTTLGKVIGGGLPVGAYGGRADIMAMVAPAGPM
YQAGTLSGNPLAMTAGIKTLELLQRPGTYQYLDKVTKSLTEGLLKVARDAGHSVSGGYIS
AMFGMFFTGSPVHNYEDAKKADVAKFGRFHRGMLERGVYLAPSQFEAGFTSLAHTEADIE
RTLAAAKEVLASL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
ttggttagcacatcttcgtatcaaacaacaaaatcgaaagaaatctttacagccgctcaa
aaattaatgccggggggtgtaagttcccccgtgcgggcctttaaatccgtcggtggtcaa
cccatcgtttttgaaagcgtcaaaggggcctatattcgcgacgtggacggtaacgaatac
atcgactatgtgggaacttgggggccggctatctgtggtcatgcccatcccgaagtgatt
gccgccctacacgatgccctagacaaaggaaccagtttcggcgctccctgtgttcaggaa
aatattctcgctgaaatggtgattgatgccgttcccagcattgaaatggtgcgttttgtc
aattccggcaccgaagcctgtatgtccgtcctgcgcttaatgcgggcttttaccggccgg
gataaaatcatcaaattcgagggctgttaccacggtcacgccgatatgttcctcgttaaa
gccggctctggtgtagcgaccctgggcctacccgactcgccgggggttcccaaaaccacc
actaacaacactttaaccgccccctacaatgacctggaagcggtcaaagccctctttgtc
gaaaatcccgactcgatcgccggggtgattttagagccagtggtgggtaatgccggcttt
atcgtgccggatgctggctttttagagggattgcgggaattaaccaaggaatacggagcc
ttattaatgtttgatgaggtaatgaccggatttcgcatcgcctacggtggcgctcaggaa
aaattcggcattacccccgatttaaccaccctgggcaaagttatcggcggtgggctgccg
gtgggggcctacggcggtcgggccgatattatggcgatggtggctccggccggcccgatg
taccaagcgggaaccttatccggcaaccctttggccatgacagcaggaattaaaaccctc
gagttactccagcgccccggcacctaccaatatctcgataaagtgaccaaatccttaact
gaagggctgctgaaagtggccagagatgctggtcacagcgtttctggaggttatattagc
gccatgttcggaatgtttttcactggctcccccgtacataactatgaagatgccaaaaag
gccgatgtggctaaattcggtcgttttcaccggggaatgttggaaagaggcgtttatcta
gctccttcccagtttgaagctggttttacttctttagctcacacagaggccgatatcgaa
cggactttggccgccgctaaggaggttttagcaagtttatag

DBGET integrated database retrieval system