KEGG   Microcystis aeruginosa: MAE_51820Help
Entry
MAE_51820         CDS       T00647                                 

Definition
(GenBank) O-acetylhomoserine/O-acetylserine sulfhydrylase
  KO
K01740  O-acetylhomoserine (thiol)-lyase [EC:2.5.1.49]
Organism
mar  Microcystis aeruginosa
Pathway
mar00270  Cysteine and methionine metabolism
mar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    MAE_51820
Enzymes [BR:mar01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.49  O-acetylhomoserine aminocarboxypropyltransferase
     MAE_51820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_1_2 Aminotran_5 Beta_elim_lyase Met_gamma_lyase GDC-P
Motif
Other DBs
NCBI-ProteinID: BAG05004
CYORF: MAE_51820
UniProt: B0JXW6
Position
complement(4754345..4755466)
Genome map
AA seq 373 aa AA seqDB search
MNPTTDVFEKRIAALEGGAAALATSSGQAAQFLAIANIAGAGDNIVSTSYLYGGTYNQFK
VSLPRLGINVKFVDGDEAEAFRAAIDDRTKALYVETISNPRFNIPDFAALAHIAHENGIP
LIVDNTFGCGGYLCRPIEQGADIVVQSATKWIGGHGTSIGGVIVDSGKFDWGNGKFPQFT
EPAPGYHGLNFYEVFGPSGPLGNIAFIIRARVEGLRDFGPALSPFNAFLLLQGLETLSLR
VDRHVSNALALANWLKEQPQVQWVDYPGLPEHPYHERAKKYLKHGFGGVLAFGIRGGFEA
GRNFINRVKLASHLANVGDAKTLVIHPASTTHQQLNEEEQRSAGVTPELIRVSVGLEHID
DIIEDFQQTFQSL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgaccaccgatgtcttcgagaagcggatcgccgctttagaaggaggcgcggcg
gccctggccacctctagcggtcaggcggcgcaatttctagcgatcgctaatattgccggt
gcgggggataatatcgtttccactagctacctctacggcggaacctataatcagttcaaa
gtctccctaccgcgtttaggaataaatgtcaagttcgtcgatggcgatgaggccgaggct
tttcgagcggcgatcgacgatcgcactaaagccttatacgtcgagacgatcagcaatccc
cgatttaatattcccgattttgccgccctggcccatatcgcccacgagaacggcattccc
ctgatcgtcgataataccttcggctgcggcggctatctctgtcgcccgatcgaacagggg
gccgatatcgtggtgcaatcggccaccaaatggatcggcggtcacggcacttccatcggc
ggagtaatcgtcgattcggggaaattcgactggggaaacggcaaatttccccagtttacc
gaacccgcgccgggttatcacgggttgaatttctacgaggtgttcggaccgtccggccct
ttgggcaatatcgcctttattatccgggcccgggtggagggattgcgggacttcggaccc
gccttgagtccgtttaacgcatttttactgctacagggattggaaaccctctccctacgg
gtcgatcgtcatgtatccaatgcgttggccctggcgaactggctcaaagaacagccacag
gtgcaatgggtggactatcccggattaccggaacatccttaccacgaacgggcgaagaag
tacctaaaacacggcttcggcggggttttagccttcgggattcggggcggtttcgaggcc
gggcggaattttatcaaccgggtgaaactggccagtcatctcgccaatgtgggcgacgca
aaaaccctggttatccatcccgcctccacgactcaccagcagttaaacgaggaagaacag
cgttcggcgggagtaacgcccgaattaatccgcgtttccgtgggtttggaacatattgac
gatattatcgaggatttccagcaaactttccagagtttataa

DBGET integrated database retrieval system