KEGG   Microcystis aeruginosa: MAE_59370Help
Entry
MAE_59370         CDS       T00647                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mar  Microcystis aeruginosa
Pathway
mar00260  Glycine, serine and threonine metabolism
mar00750  Vitamin B6 metabolism
mar01100  Metabolic pathways
mar01110  Biosynthesis of secondary metabolites
mar01120  Microbial metabolism in diverse environments
mar01230  Biosynthesis of amino acids
Module
mar_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mar00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MAE_59370 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MAE_59370 (thrC)
Enzymes [BR:mar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MAE_59370 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peripla_BP_6 TPP_enzyme_N CoA_binding_2 PK_C
Motif
Other DBs
NCBI-ProteinID: BAG05759
CYORF: MAE_59370
UniProt: B0JJ51
Position
5472891..5474000
Genome map
AA seq 369 aa AA seqDB search
MTTISRSIPQSPTKSSSIGGWRGLIEEYRQFLPVSSNTPVITLLEGNTPLIPAPYLSAQI
GRDVKVFVKYDGLNPTGSFKDRGMTMAISKAKEEGAKAVICASTGNTSAAAAAYARRAGM
RAFVIIPDGYVALGKLAQALLYGAEVIAINGNFDDALKIVRQLSENYPVTLVNSVNPYRL
EGQKTAAFEIVDVLGNAPDWLCIPVGNAGNISAYWMGFCQYHQIGKCDRLPKMIGFQAAG
AAPFISKQPVDHPETLATAIRIGNPANWEKAWAASHASQGQFHAVSDEEILAAYRILGGQ
EGVFCEPASAASVAGLLKVHQQVPDGATVVCVLTGNGLKDPDSAVKHSNNQLKSGIAPEL
TQVAQIMGF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgacaactatttctcgatcgatcccccaatcacccactaaatcctcgtctatcggcggc
tggcgcggtttgatcgaagaatatcgccaatttctgcccgtaagcagtaacacccctgta
attaccctcctagaaggcaatacacccctgatccccgccccctatctctcagcacaaatc
gggcgcgatgtcaaggtttttgtcaaatatgatggtttaaatcccaccggcagctttaaa
gaccggggcatgaccatggccatctcgaaagctaaggaagaaggggcaaaagcggtgatt
tgtgccagtaccggcaacacctcggcggcggcggcagcctatgcaagaagagccgggatg
cgggcctttgtgattatccccgacggttatgtggccttaggaaaattagcccaggcttta
ttgtacggagcggaagtcatcgctattaatggcaacttcgatgatgccctcaagattgtc
cgccaactatcagaaaattatcccgtaactttagtcaattccgtcaatccctaccgttta
gagggtcaaaaaaccgccgctttcgagattgtcgatgtcttgggtaatgctcccgactgg
ttatgtattcccgtgggtaatgcgggcaatattagcgcctattggatgggattctgtcag
tatcaccagataggcaaatgtgaccgactgccgaagatgatcggttttcaggccgccggg
gccgccccttttatctccaaacaaccggttgaccatcccgaaaccctagccacggctatc
cgtatcggcaaccccgctaactgggaaaaagcctgggccgctagtcacgctagtcaaggg
caatttcacgcggtcagcgatgaggaaatattagcagcctatcggattttagggggccaa
gagggggttttctgtgaaccagccagcgccgcttctgtggcaggattattaaaagtgcat
caacaggttcccgatggggccaccgtagtgtgtgttttaacgggaaatggactaaaagac
ccagattcggcggtaaaacacagcaataatcaactaaaatctgggattgcgcccgaatta
acccaagtggctcaaattatgggcttctaa

DBGET integrated database retrieval system