KEGG   Microcystis aeruginosa: MAE_60410Help
Entry
MAE_60410         CDS       T00647                                 

Definition
(GenBank) putative glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
mar  Microcystis aeruginosa
Pathway
mar00220  Arginine biosynthesis
mar00250  Alanine, aspartate and glutamate metabolism
mar00471  D-Glutamine and D-glutamate metabolism
mar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mar00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MAE_60410
   00220 Arginine biosynthesis
    MAE_60410
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    MAE_60410
Enzymes [BR:mar01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     MAE_60410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: BAG05863
CYORF: MAE_60410
UniProt: B0JK09
Position
5589270..5590163
Genome map
AA seq 297 aa AA seqDB search
MNRLARLRVEDIQAWVGEVHLSDRKGQTAYYIPVLNQVNPEVFALQIHCLEGEILSWGDE
TVTFPLMSVIKPFLLLYLLTHLGEDAVFRRVGKQASSYPFNSLTQLQEDCGFPRNPMINS
GAIALTDLLAGETPESRCENLLLWLNEMGNCQLFLDHSVLDSVHSYPNAHNQALSLELEK
NGYISHRYLALETYNRICCLSGKIADLANLGKLILASSFAEIILEIMTNCGLYEASQQFA
LEVGFPTKSGVSGALLSIVPKQGAIACYSPLLNEQGNSILGLNLLTYISRWMELNIR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgattagctagattaagggtggaagatatacaagcttgggtcggggaagtgcat
ttatcggataggaagggtcagactgcctattatataccggttttgaaccaagttaatccc
gaggttttcgctctccagattcactgtcttgagggggagattttgtcttggggagatgaa
actgtaacttttcctttgatgagtgtgattaaaccttttttgttattatatcttttaact
catttgggggaagatgctgtttttcgtcgcgtgggaaaacaagcttctagttatcctttt
aattccttaactcaactgcaagaggattgcggttttccccgtaatcctatgattaatagt
ggtgcgatcgccttgacagacttattagcaggagaaacgccagaatctcgctgtgaaaat
ttgcttttatggttaaatgaaatgggtaattgtcaattatttctcgatcactctgtgctt
gattctgttcactcctatcctaatgcacacaatcaagctttaagcttagaattagaaaaa
aatggttatatcagtcatcgttatttagccctagaaacctacaatcgaatctgttgttta
tctggaaaaattgccgatcttgctaatttaggtaagttgattttagcttcttcttttgcc
gaaattattctagaaattatgactaattgtggactctacgaagcttcccaacaattcgcc
cttgaggtgggttttcccactaaatcgggagttagtggggccctattatcaattgtaccg
aaacagggagcgatcgcttgttatagtcctctgttaaatgagcaaggtaattcaatttta
ggacttaatttactaacatatataagtaggtggatggaattaaatataagatga

DBGET integrated database retrieval system