KEGG   Marinobacter sp. Arc7-DN-1: D0851_05025Help
Entry
D0851_05025       CDS       T05619                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mara  Marinobacter sp. Arc7-DN-1
Pathway
mara00071  Fatty acid degradation
mara00072  Synthesis and degradation of ketone bodies
mara00280  Valine, leucine and isoleucine degradation
mara00310  Lysine degradation
mara00362  Benzoate degradation
mara00380  Tryptophan metabolism
mara00620  Pyruvate metabolism
mara00630  Glyoxylate and dicarboxylate metabolism
mara00640  Propanoate metabolism
mara00650  Butanoate metabolism
mara00900  Terpenoid backbone biosynthesis
mara01100  Metabolic pathways
mara01110  Biosynthesis of secondary metabolites
mara01120  Microbial metabolism in diverse environments
mara01130  Biosynthesis of antibiotics
mara01200  Carbon metabolism
mara01212  Fatty acid metabolism
mara02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mara00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    D0851_05025
   00630 Glyoxylate and dicarboxylate metabolism
    D0851_05025
   00640 Propanoate metabolism
    D0851_05025
   00650 Butanoate metabolism
    D0851_05025
  09103 Lipid metabolism
   00071 Fatty acid degradation
    D0851_05025
   00072 Synthesis and degradation of ketone bodies
    D0851_05025
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    D0851_05025
   00310 Lysine degradation
    D0851_05025
   00380 Tryptophan metabolism
    D0851_05025
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    D0851_05025
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    D0851_05025
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    D0851_05025
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mara04147]
    D0851_05025
Enzymes [BR:mara01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     D0851_05025
Exosome [BR:mara04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   D0851_05025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AXS85191
UniProt: A0A346S6G5
Position
complement(1082368..1083633)
Genome map
AA seq 421 aa AA seqDB search
MRRVAVLGGNRVPFARSNTAYSKISNQELLTSALRGLVDRYSLQGKRLGEVAAGAVIKHP
RDFNLTRESAMSCGLAPETPAYDIQLACGTGLEAAILVANRIALGQIECGIAGGTDTTSD
APIGVSEGLREILLDLNRAKTTGERLKILARFRPAHLKPEVPENREPRTGMSMGEHAQVM
AREWDIPREDQDRLAWESHQKLAKAYEEGFFTDLLTPLAGLEKDNILRPDTTLEKLATLK
PVFDRDNGTMTAANSTALTDGASCVLLASEEWAKENNHEVKAWLTFSEVAAVDFVDKKEG
LLMAPAYAVPRMLEKAGLTLQDFDFYEIHEAFASQVLCTLKAWQDPAFCKDRLGLDKPVG
GIDRDKLNVKGSSLATGHPFAATGGRIIATLAKLLEEKGSGRGLISICTAGGQGVTAILE
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
attcgccgcgtagcggtgctgggtggtaaccgggttccgtttgcccggtccaataccgcc
tatagcaagatcagtaaccaggagttgctgacgtccgcgctgcgggggctggtggatcgg
tacagtcttcagggcaagcggctgggggaagtggcggcaggggcggtgatcaagcatccc
cgggattttaaccttacccgggagtcggcgatgagctgtggtctggcgcctgagacaccg
gcttatgatattcagctggcctgcgggacggggctggaggcagccattctggtggccaac
aggattgccctggggcagatcgaatgtggtattgccggtggtaccgataccacgtccgat
gcgccgattggtgtaagcgaggggcttcgggagattctgctggatctgaaccgggccaaa
accaccggcgagcggttgaagattctggcgcggttccggcccgcgcacctaaagcccgag
gttccggagaaccgcgagcctcgcaccggcatgtccatgggggagcatgcccaggtgatg
gccagggagtgggacattccccgggaagatcaggacaggctggcctgggagagtcatcag
aagcttgccaaggcctatgaagaggggttctttacagatttgctgacgccgttggcgggg
ctggagaaggataatattctgcggccggatacgacccttgagaagctggcgacgctcaag
ccggtgtttgaccgggacaacggcaccatgacggcggccaacagcacggcgctgactgat
ggcgcctcctgcgtgctgctggccagtgaggagtgggcgaaagagaataaccatgaggtg
aaggcctggttgacgttctccgaggtggcagcggtggattttgtggacaagaaagagggg
ctgctgatggcgccagcttacgccgtgccccggatgctggaaaaagcggggctgacactt
caggatttcgatttctacgagatccacgaagccttcgcctcgcaggtgctgtgtactctg
aaagcctggcaggatcccgccttctgcaaggaccgtctggggctggacaagccggtgggc
ggcatcgaccgggacaaactcaatgtgaaaggcagcagcctggccaccggccatccgttc
gccgccaccggcgggcgcatcattgcgaccctggccaagttgctggaggaaaagggcagt
ggccgcggcctgatctccatctgcacggcaggcgggcagggggtaacggcgattctggag
cggtaa

DBGET integrated database retrieval system