KEGG   Marinobacter sp. Arc7-DN-1: D0851_06125Help
Entry
D0851_06125       CDS       T05619                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
mara  Marinobacter sp. Arc7-DN-1
Pathway
mara00564  Glycerophospholipid metabolism
mara01100  Metabolic pathways
mara01110  Biosynthesis of secondary metabolites
Module
mara_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:mara00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    D0851_06125 (psd)
Enzymes [BR:mara01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     D0851_06125 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AXS82646
UniProt: A0A346RZ70
Position
1315365..1316237
Genome map
AA seq 290 aa AA seqDB search
MFDKLFVLSQYIAPQRAISHLAGRLADDDRSPALKNRVIHWFIGRYGVDMSEAAEPDPEA
YPSFNAFFTRALKPGIRPLAEGEETLVSPVDGVISQLGQVTGDRIFQAKGQSFSLSELLG
GIEKTTAPFAGGEFSTIYLSPKDYHRIHMPMAGTLREMIHIPGKLFSVNPVTAENVPNLF
ARNERVACIFDTDAGPMALVLVGAMIVGSVETRWAGVVVPGSKGVTATHYEGEQAVTFAK
GEEMGRFRLGSTVIMVMPKGAVSWNSDQIAGKTVRMGEAFGTLSRTHSPV
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacaagctttttgttctgagccagtacatcgccccgcaacgggcgatttcccac
ctggccggtcgtctggccgacgatgaccgttcccccgcgctcaagaaccgggtgatccat
tggtttatcggccgctacggggtagacatgagcgaagccgccgagccggatccggaagcc
tacccgagcttcaacgctttcttcacccgggcactgaaaccgggtatccgaccactggcc
gaaggtgaagaaacgctggtcagccctgttgatggcgtgatcagccagctcggccaggta
actggcgaccggatattccaggccaagggccagtccttcagcctgagcgagctgctcggc
ggaattgagaaaaccaccgcgccgtttgcggggggcgaattttcgaccatctacctctcg
cccaaggattaccaccggatccacatgcccatggccggcacccttcgggagatgatccac
attccgggcaagctgttctcggtaaaccccgtgaccgctgaaaacgttcccaacctgttt
gcccgcaatgagcgcgttgcctgcatcttcgacactgacgcaggccccatggccctggta
cttgtgggcgccatgattgtgggcagcgtggaaacccgctgggcgggggtcgtggtgccg
ggcagcaaaggggttaccgcaactcattacgaaggcgagcaggccgtgacgtttgccaag
ggtgaggaaatgggccgcttccggttgggctcgaccgtgatcatggtaatgcccaagggt
gcagtcagttggaacagtgatcagatcgccggcaagaccgtgcgcatgggcgaggccttt
ggcacactatcccggacacactctcccgtgtag

DBGET integrated database retrieval system