KEGG   Marinobacter sp. Arc7-DN-1: D0851_08370Help
Entry
D0851_08370       CDS       T05619                                 

Gene name
hemN
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
mara  Marinobacter sp. Arc7-DN-1
Pathway
mara00860  Porphyrin and chlorophyll metabolism
mara01100  Metabolic pathways
mara01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mara00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    D0851_08370 (hemN)
Enzymes [BR:mara01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     D0851_08370 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: AXS83045
UniProt: A0A346S0B9
Position
complement(1768186..1769604)
Genome map
AA seq 472 aa AA seqDB search
MTSDPALKTQDSALPEFIWDDALIRRYDLSGPRYTSYPTAVEFNQNYPIEDMVKAAARSK
ASDRPLSLYTHLPFCAHLCYYCACNKVITKKRDKAMPYVERLLKEAAIQSRLFGANRPVT
QLHWGGGTPTFLPKEVMEHLMAGYGELFNLQTGDDRDYSVEIDPREVDQDTLPTLWDLGF
NRISLGVQDVNPEVQKAVNRIQPRDMTEAVLSEARRIGFRSINLDLIYGLPYQTPESFAE
TLEAVIEMSPDRLSVFSYAHLPDRFYPQTRIQSDTLPSPQQKLTILHNTINRLLEAGYEY
IGMDHFAKPDDSLAVAQREGRLHRNFQGYTTHSECDLVSLGVSAIGQTDDAYFQNNHDLP
SWEASIDAGQLAITKGVNLTRDDRIRRWVIGQLICQFRLDRQQFAAVWQEDLDRYFADEL
SRLKPMVQDELIADDGSVLQVQPAGRLLIRAICQIFDLYRKEGASQRFSRII
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgacctccgaccctgcactcaaaacccaagactccgcattgccggaattcatctgggac
gacgccctgatccgccgctacgacctcagtggcccgaggtacacctcctacccaacggcc
gttgagttcaaccagaactacccgattgaggacatggtcaaggccgccgcccgcagcaag
gccagcgaccggccattatcactctacacccacctgccgttctgcgcgcacctgtgctac
tactgcgcctgcaataaggtgatcaccaagaaacgtgacaaggccatgccctacgtggag
cggctgctgaaagaagccgccatccagtcaaggctgttcggtgcgaaccgaccggttacc
cagctgcactggggcggcggcacccccacgtttttgccgaaggaggtgatggaacatctg
atggcggggtatggggagctgttcaatctgcaaaccggtgatgaccgggactacagcgtt
gagatcgaccctcgggaagtggaccaggacaccctgcccacactctgggatcttgggttc
aaccggatcagcctgggtgtccaggacgtgaaccccgaggtgcagaaggcggtgaaccgc
atccagccccgggacatgaccgaggccgtgctgagtgaggcacggcggattggcttccgc
tccattaacctggatctgatctacggcctgccctaccagaccccggaaagcttcgcggaa
accctggaggcggtcatcgaaatgtcgccggaccggctctccgtattcagctatgcgcac
ctgccggaccgcttttatccgcagacccggatccagtccgatacgctgccgagcccgcag
cagaaactgaccattctccacaacaccatcaaccgcctgctggaagccggctacgaatac
atcggcatggaccacttcgccaagccggatgacagcctggctgtggcccagcgggaaggc
cggctgcaccggaacttccagggttacaccacccattcggagtgcgatctggtgtccctg
ggtgtgtcggccattggtcagaccgacgatgcctatttccagaacaaccacgacctgccg
tcctgggaagcgtccattgatgccggccaactggcgatcaccaaaggcgtgaacctgacc
cgtgacgaccgcattcgccgttgggtgatcggccagctcatctgccagttccggctggat
cgccagcagttcgcggcggtgtggcaggaagacctggaccgctacttcgcggatgaactc
agccgcctgaagcccatggtgcaggatgaactgattgccgatgacggcagcgttcttcag
gtccagcccgcaggccggttgctgatccgggccatctgccagatctttgatctctaccgc
aaggaaggcgccagccagcggttctcccggattatctga

DBGET integrated database retrieval system