KEGG   Marinobacter sp. Arc7-DN-1: D0851_09905Help
Entry
D0851_09905       CDS       T05619                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mara  Marinobacter sp. Arc7-DN-1
Pathway
mara00010  Glycolysis / Gluconeogenesis
mara00053  Ascorbate and aldarate metabolism
mara00071  Fatty acid degradation
mara00280  Valine, leucine and isoleucine degradation
mara00310  Lysine degradation
mara00330  Arginine and proline metabolism
mara00340  Histidine metabolism
mara00380  Tryptophan metabolism
mara00410  beta-Alanine metabolism
mara00561  Glycerolipid metabolism
mara00620  Pyruvate metabolism
mara00625  Chloroalkane and chloroalkene degradation
mara00903  Limonene and pinene degradation
mara01100  Metabolic pathways
mara01110  Biosynthesis of secondary metabolites
mara01120  Microbial metabolism in diverse environments
mara01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mara00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D0851_09905
   00053 Ascorbate and aldarate metabolism
    D0851_09905
   00620 Pyruvate metabolism
    D0851_09905
  09103 Lipid metabolism
   00071 Fatty acid degradation
    D0851_09905
   00561 Glycerolipid metabolism
    D0851_09905
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    D0851_09905
   00310 Lysine degradation
    D0851_09905
   00330 Arginine and proline metabolism
    D0851_09905
   00340 Histidine metabolism
    D0851_09905
   00380 Tryptophan metabolism
    D0851_09905
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    D0851_09905
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    D0851_09905
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    D0851_09905
Enzymes [BR:mara01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     D0851_09905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LPD7 DUF1487
Motif
Other DBs
NCBI-ProteinID: AXS83329
UniProt: A0A346S153
Position
complement(2106824..2108266)
Genome map
AA seq 480 aa AA seqDB search
MPPDKAFIGGEWVASATTLKVEGPSHGETISQIARCGHREVENAALAADKAFSGQLGSWS
SWSARRRGEWLLVLADAIKNDHDRLAALECADTGKPMAQADADITACERYFRFYGGAADK
LHGETIPFDNGFAVMTLREPYGVCAQIIPWNYPAQIFGRCVAAALAAGNTVVLKPAEDAC
LSVLRLAELASECGLPAGALNVVPGLGREAGVALAAHSGIQHLSFTGSPETGTLVAQAAA
RHHVPVTMELGGKSPQIIFADADLDAALDAVVKGIVQNAGQTCSAGSRLLIQEEVAEAFL
SRLADRFSSLRCDAGEADADCGPLINARQKSVLESRLASALADGVKVLAEGRLAEAAPAG
GHFVVPQVLVGIPDGHELLREELFGPVLVVQCFKGESDALAQANATDFGLCAGVWTADGG
RQLRLAKQIRSGQVFVNNYGAAGGIELPFGGVGRSGHGREKGFEGLRSFTRIKTVAIRHG
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgccgccagacaaagccttcataggcggagagtgggttgccagtgcaacgaccctgaag
gtagaggggccgtcgcacggggaaacgatcagccagattgcccgatgtgggcatcgtgaa
gtcgagaatgccgcgttggctgccgacaaggcattttcgggtcagcttggtagctggtcg
agctggagtgcccgtcggcgtggtgagtggctactggtcctcgctgatgctatcaaaaat
gaccacgacagacttgctgcgctggagtgtgcggacactggcaagcccatggctcaggca
gatgccgatataaccgcctgcgaacgttactttcgtttctacggtggggccgccgataag
ctgcacggtgagaccattccattcgataacgggtttgccgtgatgaccctgcgtgagcct
tacggtgtctgcgcgcaaataattccctggaattaccccgcacagattttcgggcgttgt
gtggcggctgcgctggccgctgggaacacggtagtactaaagccggcggaagacgcctgc
ctcagtgtgctgcgcctggctgaactggccagtgaatgtggtctgccggcgggagcgctt
aatgtcgttcctggcctgggccgcgaggcaggtgttgcgctggcagcccactcaggcatt
caacatctgtcattcaccggttcgccggagactggcacgcttgttgcccaggctgcggcc
agacatcacgttccggtcaccatggagcttggggggaaatctccccagattatttttgca
gatgccgaccttgatgcggcgctcgatgcggttgttaaaggtatcgttcagaacgctggc
cagacctgttccgccggcagtcgcttgctgattcaggaggaggtagccgaggcgttcctc
agccgtctggctgatcgtttttcttccctgcggtgtgatgccggtgaggccgatgccgat
tgtggaccactgatcaacgcccggcagaagtcggtgcttgaatcgagacttgcatcggcc
ttggccgatggtgtgaaggtactggccgaaggtcgtttggcagaggccgcaccggcaggt
gggcactttgtcgtgcctcaggttcttgtcggtatccccgatggccatgagttactgcgc
gaggagttgttcgggcccgttcttgtggttcaatgcttcaagggcgaatccgatgcgctg
gcacaggctaatgcgacggatttcggtttgtgcgcgggcgtgtggacggcggacggaggg
cgacaattgcgtctggcgaaacagatccgaagcggccaggtgtttgtcaataactacggt
gccgctggtggtattgagttgccgttcggtggcgtggggcgctctggacacggtcgcgaa
aagggcttcgagggcttacgcagctttacccgtatcaagaccgtcgccattcggcatggt
tag

DBGET integrated database retrieval system