KEGG   Marinobacter sp. Arc7-DN-1: D0851_13300Help
Entry
D0851_13300       CDS       T05619                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
mara  Marinobacter sp. Arc7-DN-1
Pathway
mara00010  Glycolysis / Gluconeogenesis
mara00020  Citrate cycle (TCA cycle)
mara00620  Pyruvate metabolism
mara01100  Metabolic pathways
mara01110  Biosynthesis of secondary metabolites
mara01120  Microbial metabolism in diverse environments
mara01130  Biosynthesis of antibiotics
mara01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mara00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D0851_13300
   00020 Citrate cycle (TCA cycle)
    D0851_13300
   00620 Pyruvate metabolism
    D0851_13300
Enzymes [BR:mara01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     D0851_13300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_16
Motif
Other DBs
NCBI-ProteinID: AXS83911
UniProt: A0A346S2T5
Position
complement(2832134..2833669)
Genome map
AA seq 511 aa AA seqDB search
MSNTYHDLSTARLVEVALARDEGQLASNGSLVVTTGDRTGRSPMDRYIIEEPSTSDDIHW
GPINRPFDAEKFDALWDRVEAYIAEKDRFISHVHVGSDPEHYLPVKMTTETAWQNLFGRN
LFIRPDSYNPADKQEWQILNAANFECVPERDGTNSDGCVMINFARRKVLLAGMHYAGEMK
KAMFSVQNFLLPEKDVLPMHCSANVGEDGETCLFFGLSGTGKTTLSADPHRFLIGDDEHG
WGPGTVFNIEGGCYAKCIDLSQKNEPIIWNAIRFGAIVENVMIDPETREPDYTDVSLTEN
SRCAYPLEHVEKRVIENRAGEPSHIVFLTCDMTGVLPPVSILSREGAAYHFLSGYTALVG
STEMGSSSKLKSTFSTCFGAPFFPRPAGVYAELLMKRMDEFGSKVFLVNTGWTGGPYGEG
ERFSIPTTRAIIAAIQNGDLDDVATEHLPTLNLDVPKRVPGVDTKLLNPRNTWVSPDYYD
GKAQELIAQFVENFKKFDVAEAIVDAGPKLS
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaacacttatcatgatctgagtacagcacgactggtcgaggtggcactggcacgt
gacgaaggccagctggcttccaacgggtcactggtggtaacaaccggtgatcgcacaggc
cggtctcccatggaccgttacattatcgaggagccaagcacctctgacgacatccattgg
ggtccgatcaaccgtccgtttgacgctgaaaaattcgacgcactctgggaccgtgttgaa
gcctacattgccgaaaaagaccgttttatatcccacgttcacgtcggctccgaccccgag
cactatctgccggtgaaaatgaccaccgaaaccgcctggcagaacctgttcggccgcaac
ctgtttatccgcccggacagttacaacccggccgacaagcaggaatggcagatcctgaac
gccgccaacttcgagtgcgtgcccgagcgggacggcaccaacagtgacggctgcgtcatg
atcaactttgccaggcgcaaggttttgctggcaggcatgcactacgccggcgaaatgaaa
aaagccatgttctccgtgcagaacttcctgctgccggaaaaagacgtgctgccgatgcac
tgctccgccaacgtgggcgaggacggcgaaacctgcctgttcttcggcctgtccggcact
ggcaagaccaccctgtctgctgacccgcaccgtttcctgatcggcgatgacgagcatggc
tggggccctggcaccgtattcaatattgagggcggctgctacgccaagtgcatcgacctc
tcccagaagaacgaaccgatcatctggaacgccatccgttttggtgccatcgtcgaaaac
gtgatgatcgacccggagacccgcgaaccggattacaccgacgtttctcttaccgaaaac
tcccgttgcgcttacccgctcgagcacgtcgagaaacgggtgatcgagaaccgtgccggt
gaaccctcgcacattgtgttcctgacctgtgacatgaccggcgtactgccgcccgtgtcc
atcctgagccgtgaaggtgccgcctatcacttcctgagcggctataccgcgctggtcggc
tccaccgagatgggatcttcctccaagctgaagtccaccttctccacctgcttcggcgca
ccgttcttcccgcgcccggccggcgtttacgcagaactgctgatgaagcgcatggacgag
tttggcagcaaggtcttcctggtcaatacaggctggaccggtggtccctacggtgaaggc
gagcgtttcagcatcccgacgacccgcgccatcatcgccgcgatccagaacggtgatctt
gacgatgtggcaaccgagcacctgcccaccctgaatctggacgttccgaaacgtgtaccc
ggcgtggataccaagctgctgaacccgcgcaatacctgggtaagcccggactactacgac
ggcaaggcccaggagctgattgcccagttcgtggagaacttcaagaagttcgatgtggca
gaggcgattgtagacgctggccccaagctgagctga

DBGET integrated database retrieval system