KEGG   Marinobacter sp. Arc7-DN-1: D0851_20075Help
Entry
D0851_20075       CDS       T05619                                 

Gene name
oadA
Definition
(GenBank) oxaloacetate decarboxylase subunit alpha
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
mara  Marinobacter sp. Arc7-DN-1
Pathway
mara00620  Pyruvate metabolism
mara01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mara00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    D0851_20075 (oadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mara02000]
    D0851_20075 (oadA)
Enzymes [BR:mara01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     D0851_20075 (oadA)
Transporters [BR:mara02000]
 Other transporters
  Primary active transporters [TC:3]
   D0851_20075 (oadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 PTS_EIIA_1 RnfC_N ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AXS85105
UniProt: A0A346S679
Position
4288941..4290728
Genome map
AA seq 595 aa AA seqDB search
MTDTKKPLGITDVILRDAHQSLLATRMRLDDMLPIAEKLDKVGFWSLESWGGATFDSCIR
YLGEDPWERIRELKKAMPNTQQQMLLRGQNLLGYRHYADDVVDRFCERAAENGVDVFRIF
DAMNDPRNLDRAIKAVRKTGKHAQGTIAYTTSPVHTIDMWVELAKEVADMGADSIAIKDM
AGILKPYVAFDLVSRLKKELDIPIHMQCHATTGMSTATAIKAAEAGIDNVDTAISSMSMT
YGHSPTEAVVAILEGTDRDTGLDLNLLEEIASYFRQVRKKYAKFEGSLRGTDSRILIAQV
PGGMLTNMENQLREQNASDKFDQVLEEIPKVREDLGFIPLVTPTSQIVGTQAVLNVLTGE
RYKSISKETSAILKGEYGAAPAPMNKELQERVLDGKEPVTCRPADLIEPEMDKLTDELKK
LADDKGIKLAENTVDDVLTYALFPQIGLKFLENRDNPDAFEPVPTAESAAPARKADGPET
YTVEVNGKKFVVAVSEGGEITQIQGEGGAASAPVASSAPAPAAGEGEPVVAPLGGNIFKV
LVSPGDAVEEGDVLIILEAMKMETEIRAPKAGTIGEIFIKVGDAVSPDDEMLTIA
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgactgacacaaagaaaccgctggggattacggacgttatcctgcgtgacgcccaccag
tccctgcttgccacccgtatgcggctggatgacatgctgcctattgccgagaaactcgac
aaggtcggtttctggtcactggaatcctgggggggggctacctttgattcctgcatccgt
tacctgggcgaagacccctgggagcgcatccgcgagctgaagaaagccatgcccaatacc
cagcagcagatgcttctgcgcggccagaacctgttgggttaccgtcattacgcggatgat
gtggtggaccgtttctgtgagcgtgccgccgagaacggcgtcgacgtgttccgtattttt
gatgcgatgaacgatccccgtaacctggatcgcgccatcaaggccgtccgtaagaccggc
aagcatgcccagggcacgattgcctacaccaccagcccggtgcacaccatcgacatgtgg
gtagagctggcgaaggaagtcgccgacatgggtgcggactccattgccatcaaggatatg
gcgggtattctcaagccttatgtggcgttcgatctggtcagccgtctgaagaaagaactg
gatattccgattcacatgcagtgccacgccaccactggcatgtcgactgccaccgccatc
aaggcagcggaagccggtattgataacgttgacaccgctatatcttccatgagtatgacg
tacggtcactcgcccaccgaggccgtggtcgccattctggaaggtactgatcgggatacc
ggtcttgacctgaacctgcttgaagaaatcgccagctacttccgccaggtacgcaagaag
tacgcgaagtttgaaggcagtctccgtggtaccgattcccgcatcctgattgcccaggta
ccgggtggcatgctgaccaacatggaaaaccagctgcgcgaacagaacgcaagcgataag
ttcgatcaggttctggaagagattcccaaggtccgcgaagacctgggtttcattccgctg
gtaactccgacttcccagatcgtgggtacccaggcggtactgaacgttctgacaggcgag
cgctacaagtccatctccaaagaaacctctgcaatcctgaaaggcgagtacggcgctgca
ccggcgccgatgaacaaggaattgcaggagcgtgtcctcgatggaaaagagccagttacc
tgccgtccggcggatctgattgagccggaaatggacaagctgaccgacgagctcaagaag
ctggcggacgacaagggcatcaagctggcggaaaacaccgtagacgacgtactgacctac
gcgttgttcccgcagattggcctgaagttcctggaaaaccgtgacaacccggacgccttc
gagccggttccgaccgcagaaagtgccgctcctgccaggaaggctgacggccccgagact
tacaccgtggaagtgaacggcaagaagtttgtggttgcggtttccgaaggtggtgagatc
acccagattcagggtgagggtggtgcagcttctgcaccggtggcttcctccgcaccggca
cccgctgctggtgaaggtgagccggtggttgcgcctctgggcggcaacatcttcaaggtt
ctggtttctccgggtgacgccgtggaagagggcgatgtgctgatcattctcgaggccatg
aaaatggaaaccgagatccgcgcacccaaggccggtactatcggtgaaatcttcatcaag
gtcggtgatgccgtctctcctgatgatgaaatgctgacaatcgcataa

DBGET integrated database retrieval system