KEGG   Maribacter cobaltidurans: CJ263_12610Help
Entry
CJ263_12610       CDS       T05023                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
marb  Maribacter cobaltidurans
Pathway
marb00360  Phenylalanine metabolism
marb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
marb00790  Folate biosynthesis
marb01100  Metabolic pathways
marb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:marb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    CJ263_12610
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CJ263_12610
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CJ263_12610
Enzymes [BR:marb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     CJ263_12610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ASV30990
UniProt: A0A223V776
Position
complement(2855241..2856992)
Genome map
AA seq 583 aa AA seqDB search
MSYESNPILDKLPKHLKQYIKPQNYEHYTAINQAVWRYVMRKNVDYLSTVAHDSYTQGLK
KTGISIDSIPNMYGMNRILKDLGWAAVAVDGFIPPAAFMEFQAYNVLVIASDIRQLENIE
YTPAPDIIHEGAGHAPIIANPEYAAYLRRFGEIGSKAISNAKDFELYQAVRRLSIIKEAK
GTKREEIEKAENLVEELQQNMGEPSEMALIRNLHWWTVEYGLIGTLENPKIYGAGLLSSI
GESAWCMTDKVKKVPYSIEAAHTPFDITQPQPQLYVTPDFAFLSQVLEDFANTMALRTGG
LIGLQKLIDSKDLGTIELSTGLQVSGNFESVIAHNGDPIYFQTKGKSALAFREKELVGQD
INQHATGFGSPIGRLKGINIAIEDMSPRDLKAYNIYEGNEVSLDFEGGINISGKIVTGTR
NLQGQIILITFEHCKVTYNDKILFESKNELYNMAIGERIVSAYHGPADLKSFDLLDHELS
SSNPKAKSSKDEELENLYQQIRDYRNGRNTTISRNKVFKVLTEKYPLDWLLSVELYELAV
GNQDLDFASDIKAHLNSIKLENPKLGHLIDDGIGLTEKEFILQ
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgagctacgaaagcaatcccatacttgacaaactgcccaaacatttaaagcagtacata
aagccacaaaattatgaacattatacggctatcaatcaagctgtctggcgttatgtaatg
cgaaagaatgtggactatctcagtacagtagcccatgattcctatacacagggattgaaa
aaaaccgggatttccatagatagcatacccaacatgtacggaatgaaccgaattctaaag
gatttgggatgggcagcagttgctgtagacggttttattccccctgccgcctttatggaa
tttcaggcgtataatgttttggtaatcgcctcggacatcagacagcttgaaaatattgag
tacacgcccgcacctgatatcatccatgaaggagctgggcatgcgcccattatcgccaac
ccagagtatgccgcttacttaagaaggtttggcgaaattggcagcaaggccatatccaac
gccaaagattttgaactgtaccaagccgttcgacgcttgtccatcatcaaggaagccaaa
ggaacgaaacgggaggaaattgaaaaagccgaaaatttggtggaagaactacaacaaaat
atgggcgaacccagcgaaatggctttaatcaggaacctacattggtggaccgtggaatat
ggactaataggtactctagagaatccgaaaatctatggggccggactcctatcgagtatc
ggggagagtgcctggtgtatgacggacaaagttaaaaaagtaccctactccatcgaagcg
gcacatacaccctttgacattacccaaccccaaccccaactttatgtgacacccgatttc
gcatttttaagccaagtactggaggattttgccaacactatggccttacgaaccggtggc
ctgatcggactacaaaaacttatcgattcgaaagatttaggtacgatagaactaagcaca
ggattgcaggtatcaggtaattttgaaagcgtcattgcacataatggggatcccatttat
tttcagaccaaaggaaaatcggcattggcttttagggaaaaggaattggtaggacaggat
atcaatcaacatgccacgggatttggatccccaatcggaagacttaagggaatcaatatt
gccattgaagatatgagcccgagggatttgaaggcctataatatttatgaaggaaacgag
gtctctctagactttgaaggcggtatcaatatcagcggaaaaattgtaacaggaaccaga
aacctacagggacaaatcatcctcatcacctttgagcactgtaaagttacctataacgat
aagattctctttgagtccaagaacgaactgtataatatggccattggggaacggatagtc
tctgcctatcatggccctgccgatttaaaaagctttgatctgttagaccatgaactaagc
agttccaatccaaaagcgaaaagttctaaggatgaggaattagaaaatctctaccaacaa
attagggactatagaaacggcagaaacactaccatttcaaggaataaggtttttaaggta
cttactgagaaatatcctttggattggctgctttctgtggaattatatgaactggcagta
ggaaaccaggatttggattttgccagtgatataaaggcccatttgaattcgatcaaattg
gaaaatccgaagttaggccatctgatcgatgacggcattgggctgacggaaaaggaattt
atattacaataa

DBGET integrated database retrieval system