KEGG   Maribacter cobaltidurans: CJ263_17675Help
Entry
CJ263_17675       CDS       T05023                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
marb  Maribacter cobaltidurans
Pathway
marb00030  Pentose phosphate pathway
marb00480  Glutathione metabolism
marb01100  Metabolic pathways
marb01110  Biosynthesis of secondary metabolites
marb01120  Microbial metabolism in diverse environments
marb01130  Biosynthesis of antibiotics
marb01200  Carbon metabolism
Module
marb_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
marb_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:marb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CJ263_17675 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CJ263_17675 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:marb04147]
    CJ263_17675 (zwf)
Enzymes [BR:marb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     CJ263_17675 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     CJ263_17675 (zwf)
Exosome [BR:marb04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CJ263_17675 (zwf)
  Exosomal proteins of colorectal cancer cells
   CJ263_17675 (zwf)
  Exosomal proteins of bladder cancer cells
   CJ263_17675 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N Hema_esterase
Motif
Other DBs
NCBI-ProteinID: ASV31899
UniProt: A0A223VAL6
Position
3958421..3959953
Genome map
AA seq 510 aa AA seqDB search
MKNTENQMLVIFGASGDLTARKLVPALYNLYESGHLPKNFVVLGASRSDLSDEDFRKKVV
LESKYLTDKIKDKNRDGIQKFAEMFFYEDLGKDYDVDYTPLRKRVGDLNDEKGTEGNIMY
YLSTPPTLYETIAKNLADAGLSTQNNGWKRLIVEKPFGYSLETAKALNKGLQQHFSESQI
YRIDHYLGKETVQNLLVTRFANSIFEPLWNRNYIDHIEITNAESVGVEKRGGYYDKSGAL
RDMFQNHLLQIVSLIVMEPPIGDGAEEIRNEKVKALKSLRVMKDEKTLHDHTIRAQYMAS
EINGEKVKGYREEEGVDPESTTETYAAIKFFVDNWRWKDVPFYVRTAKRMPTKVTEVVIH
FKTPHHQIFKESGIHSKDNKLIIRIQPDEGILIKFGVKVPGQGFKVERANLDFYYSSLVE
TRVMEAYERLLLDAMQGDATLYARADEVEAAWEFVDPILDYWQKGKDVRMYGYPSGTWGP
TNADDLIEGIGFWRNPGENLTDDENYCVLC
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatacagaaaatcaaatgctggttatttttggagcttccggtgacttgacagca
cgaaaactagtgcccgcattatataacctatatgaatctggtcatttacccaaaaacttt
gtggtattgggagcgagtagaagtgatttatctgatgaggattttcgtaaaaaggttgtt
cttgaaagcaagtatttgacggataagataaaggataaaaatagggatggaatccaaaag
tttgccgaaatgtttttctatgaagatttgggcaaggattacgatgtggattatacccca
ttgagaaaaagggttggcgaccttaacgatgaaaaggggaccgaagggaatattatgtat
tacctgtccacaccaccaactttgtatgaaaccatagccaaaaacttggcagatgccggt
ctcagtacccaaaacaatggttggaagcgcctgattgttgagaaaccgtttgggtatagc
cttgaaacagcaaaagctcttaacaaaggcctacaacagcacttttcagaatcccagatt
tatagaatagaccattatttgggcaaggagaccgttcaaaacttgttggttacccgtttt
gccaacagtattttcgagcctttatggaacaggaattatatagatcatatagagattacc
aatgccgaaagcgtaggtgtggaaaaacgaggcggatattatgataagtccggagctttg
cgggatatgttccaaaaccatttattacaaatcgtatcccttattgtaatggaaccaccc
attggtgatggggcagaggagatacgaaatgaaaaggtcaaggcactaaaatcgctgcgt
gtcatgaaagatgaaaagaccctgcatgatcatactattagggcccagtatatggcctct
gaaataaatggggaaaaagtaaagggttaccgggaggaagaaggggtagacccagagtct
acaacggaaacctatgcggccatcaaattttttgtggacaattggagatggaaagatgtt
cccttttatgttagaacggcgaaaagaatgcctactaaagtgacagaagtggtcattcac
ttcaaaaccccacaccaccaaatatttaaagaatcaggtattcatagtaaggataataaa
ttgattatcaggattcaacctgatgaaggaatccttatcaaattcggtgtaaaagtacct
ggtcaagggtttaaagtagaacgggccaatttggatttttactattccagcttagtggaa
acccgtgttatggaagcttatgaaaggctcttgttggatgctatgcaaggtgatgccaca
ttatatgccagggctgatgaggtagaagctgcatgggaattcgtagatccaattttggac
tattggcagaagggaaaggacgttcgtatgtacggctacccttctggaacctgggggccg
acgaatgctgatgatttaatagagggtattgggttttggagaaatccgggtgaaaacctt
acggacgacgagaattattgtgtgctttgctaa

DBGET integrated database retrieval system