KEGG   Methanogenic archaeon ISO4-H5: AR505_1136Help
Entry
AR505_1136        CDS       T04272                                 

Definition
(GenBank) cobyric acid synthase CbiP1
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
marc  Methanogenic archaeon ISO4-H5
Pathway
marc00860  Porphyrin and chlorophyll metabolism
marc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:marc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AR505_1136
Enzymes [BR:marc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     AR505_1136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CbiA AAA_26 MobB IstB_IS21 VirC1
Motif
Other DBs
NCBI-ProteinID: AMH94854
UniProt: A0A110A2Z4
Position
complement(1200801..1201637)
Genome map
AA seq 278 aa AA seqDB search
MKSLLFLGTSSGAGKTTLDAAFCRYLVRKGMKVAPYKASNLSLNSYVTLGGEEIGMGQAF
QAWACGIEPTGDMNPVLLKPAGSGRMQIILRGKPYQDIVRDQPWDRDEVMEKACESYDRL
IEQYDAVICEGSGSPAELNLMSTDMANVGLMKARGVKAILVGDIERGGVFAAIYGTWLLI
PDELKPLMKGFVINRFRGDASILGPGIQKVEELTGMKCFGIVPYESLKFPEEDSLSQTGG
NIGSGDLHEEFIRNLDRLIDNAVESGVDLEGIVKLLEE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgttgctcttcctgggaacttcctccggtgccggcaagaccaccctcgatgcg
gcattctgcaggtatcttgtccgtaaggggatgaaagtcgcaccctacaaggcttccaat
ctttctctgaactcatatgtcaccctcggcggggaggagatcggtatgggacaggccttc
caggcatgggcctgcggtatcgagcccaccggcgacatgaatcccgttcttctaaagccc
gcaggttcgggcaggatgcagatcatcctccgcggaaaaccatatcaggatatcgtacgc
gaccagccctgggaccgcgatgaggtcatggagaaggcctgcgaatcctatgacaggttg
atcgagcagtacgatgctgttatctgtgagggttccggatcacccgccgaactcaacctc
atgtccaccgacatggccaacgtcggattgatgaaggcccgcggagtgaaggccatcctt
gtgggcgatatcgagagaggcggcgtattcgccgccatctacggaacatggctcctgata
ccggacgaactcaagcccctgatgaagggattcgtcatcaaccgtttccgcggagacgca
tccatcctgggccccggcattcagaaagtagaggagctcacgggcatgaaatgcttcggt
atcgtgccctacgaatcgctgaaattcccagaggaggacagcttgtcccagacgggcgga
aacatcggttccggcgacctccatgaggagttcataaggaacctagacaggctcatcgac
aatgccgtagagtcgggtgtggacctcgaagggatcgtaaagcttctggaagaatga

DBGET integrated database retrieval system