KEGG   Maribacter sp. MJ134: EJ994_00995Help
Entry
EJ994_00995       CDS       T05877                                 

Gene name
apaG
Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
mare  Maribacter sp. MJ134
Brite
KEGG Orthology (KO) [BR:mare00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    EJ994_00995 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 YidC_periplas
Motif
Other DBs
NCBI-ProteinID: AZQ57451
UniProt: A0A3Q9FEA2
Position
complement(219205..219591)
Genome map
AA seq 128 aa AA seqDB search
MTTQVTKGIKISVNTNFEGTFFKNYKMHYAFGYTITIENQSKEPVQLTSRHWRIYDSLND
IEILDGEGVIGKKPVIQPGESHTYNSGCLLTSPIGAMKGHYNMVNFDSSEKFRVFIPTFK
FSAPFALN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgactacacaggttactaaaggcattaagatttcagtaaatactaattttgaaggtact
ttctttaaaaattataaaatgcactatgctttcgggtataccattacaattgagaatcaa
agcaaagaacctgtgcaactcacatcacgtcattggagaatctacgactccttaaacgat
attgaaattttggacggtgaaggtgttattggcaaaaaaccggtaattcaacccggggaa
tcgcatacctacaattccggctgcttgttaacctcccctataggagctatgaaaggacat
tataacatggtgaattttgattcctcagagaaattcagagtgttcattcctacatttaaa
tttagcgcaccgttcgccttaaattga

DBGET integrated database retrieval system