KEGG   Maribacter sp. MJ134: EJ994_10860Help
Entry
EJ994_10860       CDS       T05877                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
mare  Maribacter sp. MJ134
Pathway
mare00430  Taurine and hypotaurine metabolism
mare00620  Pyruvate metabolism
mare00640  Propanoate metabolism
mare00680  Methane metabolism
mare01100  Metabolic pathways
mare01120  Microbial metabolism in diverse environments
mare01200  Carbon metabolism
Module
mare_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:mare00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EJ994_10860
   00640 Propanoate metabolism
    EJ994_10860
  09102 Energy metabolism
   00680 Methane metabolism
    EJ994_10860
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    EJ994_10860
Enzymes [BR:mare01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     EJ994_10860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AZQ59281
UniProt: A0A3S9NTH0
Position
complement(2507238..2508425)
Genome map
AA seq 395 aa AA seqDB search
MQILVLNSGSSSIKFQIIEMPSEIIMCKGLVERIGHKNAKIHYTTKAISLSKEKAVFSHK
EGLEAITTLLMDADNGVLNTAEEIALVAHRVVHGGEHFNKPAKIDASVLAEIERLSILAP
LHNPANATGIKVAAEIFKNALQVAVFDTAFHQTLPEKAYRYAIPKALADREHIRVYGFHG
TSHHYVSEKAIDYLNKSASRIISIHLGNGCSITAVKDGKSVDHSLGFGPTNGLLMGTRSG
DIDQSVVFFLMDSLKMTSQEANELLQKQSGLLGITGYSDLRDVQTQAANGNQDCQLALDM
MAYRIKKFIGSYIAVLNGVDTLLFTAGIGENSSLLRAMVCENMDGLGIKIDLKKNQKRTD
GIQEIQHEDSRVKILVVPTNEELEIAKQAFELMNA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcagatactggtcttaaattcaggaagttcgtccattaagtttcagattattgaaatg
ccttccgaaataattatgtgtaaaggtctggtggaacgtattgggcacaaaaatgcgaag
atacattatacaaccaaggctatttcgttgtccaaggagaaagcggtttttagtcataag
gagggattagaagcgataactacgcttttgatggatgcggataatggagtattgaacacg
gcggaagaaattgctcttgtcgcccatcgtgtggtacatggtggggaacattttaataaa
cccgccaagattgatgcatctgttcttgccgaaattgaacgtttgtcaatattggcgcca
ttacacaatcccgctaacgccacgggaataaaagtagcggcagaaatctttaagaacgcc
cttcaagttgcggtgtttgatacggcctttcatcaaacgctacccgaaaaagcgtaccgg
tatgccatacccaaagcgcttgccgatagggagcatattcgggtatatggttttcatggc
acaagtcaccactatgtttctgaaaaggcaattgattatctgaacaaatcagcttctaga
ataataagtattcatttaggaaatggctgtagtattaccgctgttaaggatggaaagagt
gtggaccattccttaggttttggacccaccaacggactcctaatgggaacacgcagtggt
gatattgaccaatccgtagtttttttcctgatggacagtcttaaaatgacttcccaagaa
gcaaacgagctgttgcaaaagcaaagcggcctgttaggaattacaggatattccgattta
agggacgtacaaacgcaagcagcaaacggcaaccaagactgtcaattggcattggatatg
atggcctatcgtatcaagaaatttattggtagttatatagcagtccttaacggtgttgat
accctgttatttacagcgggtatcggtgaaaattccagtttactccgtgccatggtctgc
gaaaatatggatggcctaggaattaaaatcgatttaaaaaagaatcaaaaacgtaccgat
ggtattcaggaaatacagcatgaagactcccgggtaaagattttggtcgtgcccacaaat
gaggaattagaaattgctaaacaggcgtttgaattaatgaatgcctaa

DBGET integrated database retrieval system