KEGG   Mariniflexile sp. TRM1-10: CJ739_2129Help
Entry
CJ739_2129        CDS       T05592                                 

Definition
(GenBank) Siroheme synthase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
marf  Mariniflexile sp. TRM1-10
Pathway
marf00860  Porphyrin and chlorophyll metabolism
marf01100  Metabolic pathways
marf01110  Biosynthesis of secondary metabolites
marf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:marf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CJ739_2129
Enzymes [BR:marf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     CJ739_2129
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     CJ739_2129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M Sedlin_N Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AXP81210
UniProt: A0A385BQ82
Position
2473513..2474094
Genome map
AA seq 193 aa AA seqDB search
MERNNLYPIFLKLNSLNVLIVGGGHVAEEKLTFLLKSSPDAKVTMVSPMFREGTVELAKK
GDVKLIKRRYSKRYLKGKHIVIATTNVPSVNVKVHKHCRKRSILVNVADNPPYCDFYMGG
IVTKGNVKVAISTNGKSPTTAKRLRQFFEDVIPENVDDLVKNLNEYRKTIKGDFEQKVET
LNEFTKGLIEKKE
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggaaaggaataatttatatcctatttttttaaagctgaacagtcttaatgtgcttatt
gttggtggaggtcatgtagctgaagaaaaattaacctttttgttaaagtccagtccagat
gctaaagtaactatggtgtcgcctatgtttagagaaggtactgtagagctagcaaaaaaa
ggcgatgttaagttgataaaaagacgctatagtaaacgctatttaaaaggaaagcacatc
gttatagcaacaaccaatgtgcctagtgtgaatgtaaaagtgcataagcattgccgtaag
cgtagtattttagtaaatgttgccgataacccaccatattgtgatttttatatgggtggt
attgtaacaaaagggaatgtgaaagtagcgatttcaaccaatggaaaatcgccaacaact
gccaaacgtttgcgtcagttttttgaagatgtcattccagaaaatgtagacgatttggtt
aaaaatttaaatgaatatagaaaaacaataaaaggtgattttgaacaaaaggtggaaaca
cttaatgaatttaccaaaggattaattgagaaaaaagagtaa

DBGET integrated database retrieval system