KEGG   Marinobacter sp. CP1: ACP86_04780Help
Entry
ACP86_04780       CDS       T04052                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
mari  Marinobacter sp. CP1
Pathway
mari00670  One carbon pool by folate
mari01100  Metabolic pathways
mari01120  Microbial metabolism in diverse environments
mari01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mari00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ACP86_04780
Enzymes [BR:mari01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     ACP86_04780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AKV95535
UniProt: A0A0K1U702
Position
1005227..1006096
Genome map
AA seq 289 aa AA seqDB search
MQSQKQFKRRFSFEFFPPKTDQGKEKLQNVRNQLAEVNPDFFSVTFGAGGSTRDRTIETV
LNLHSQGISTAPHLSCVGGTRQEIGELLDLYREHGINRIVALRGDMPSGMGAAGELRYAN
ELVEFIREHSGDTFNLEVAAYPEFHPQARNAEEDLKNFARKVQAGANSAITQYFFNADSY
FYFIDRLEKMGVTIPVVPGIMPIVNFSNLVRFSDMCGAEIPRWIRKQLEAYGDDSDSIRK
FGEEVVTEMCEKLLKAGAPGLHFYTLNQVEPSISIWKNLGISEREKIAF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcccagaaacagttcaagcgtcgtttcagctttgagtttttcccgcccaagacc
gaccagggcaaggaaaagctgcagaacgtgcgcaaccagctggccgaggtgaatccggac
tttttctccgtcaccttcggcgccggtggttccacccgggaccgcaccatcgagaccgtg
ctcaacctgcatagccagggcatttccacggcacctcatctttcctgcgtcgggggcacc
cgccaggaaatcggggagcttctggatctgtaccgggagcacggaatcaaccggattgtc
gccctacggggcgacatgccctccggtatgggtgccgccggtgagctgcgctacgccaac
gagctggtggagtttatccgtgagcacagcggcgatacgtttaacctggaagtagccgcg
taccctgagtttcatcctcaggcccgcaacgccgaagaagatctgaagaactttgcccgc
aaggttcaggccggtgccaacagcgccatcacccagtacttcttcaacgcggacagctac
ttctacttcatcgaccggctggagaaaatgggcgttaccattccggtggtcccgggcatc
atgcccatcgtcaatttctccaacctggttcgtttctcggacatgtgcggcgcggaaatt
cctcgctggattcgcaaacagctcgaagcctacggcgacgacagcgattccatccgcaag
ttcggtgaggaagtggtcaccgagatgtgcgagaagctgttgaaggccggcgcgccggga
ttgcatttctataccctgaaccaggtggaacccagtatcagcatctggaagaacctgggc
atcagtgagcgggagaagattgctttctga

DBGET integrated database retrieval system