KEGG   Marinobacter sp. CP1: ACP86_10375Help
Entry
ACP86_10375       CDS       T04052                                 

Definition
(GenBank) acid phosphatase
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
mari  Marinobacter sp. CP1
Pathway
mari00230  Purine metabolism
mari00240  Pyrimidine metabolism
mari00760  Nicotinate and nicotinamide metabolism
mari01100  Metabolic pathways
mari01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mari00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ACP86_10375
   00240 Pyrimidine metabolism
    ACP86_10375
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ACP86_10375
Enzymes [BR:mari01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     ACP86_10375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: AKV96529
UniProt: A0A0K1UA93
Position
2252308..2253087
Genome map
AA seq 259 aa AA seqDB search
MNDPMVKRILITNDDGINAPGLKVLEQIARNLAEEVWVVAPEHDRSGAGQSISIHDPLRV
YEQGDRRYAVSGTPADCVLYSLARWFGETPPDLVLSGVNCGANISDSVQYSGTVGAVLSA
EHMGIPAMALSQAFLSREGVDWSPVSIHGEAIIRQLWQPGLNRAWNVNFPACEAAAISRA
RWCRESNGSIQRARLQAGQDARSLPYWWLGFDRSSRHIVAPDEDASVLRDKAIAITPLRH
QDRLPGGADVFDLAASAAH
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatcccatggtcaaacgcatcctaatcaccaatgatgacggcatcaacgcgcca
ggcctgaaagtgctcgagcagatcgcccgcaacctggccgaggaggtctgggtggtggcg
ccggagcatgatcgtagcggcgccggccagagcatctccattcatgatcctttgcgggtg
tatgagcagggtgacaggcgctatgcagtctccggtacgccggcggactgtgtgctctat
tcgctggcccggtggttcggggaaaccccgccggatctggtgctttccggggtgaactgc
ggggccaatatcagcgattccgtgcagtattccggaaccgtcggcgcggtgctgagtgcc
gaacatatgggcatacctgccatggcactgagccaggcgtttctgagtcgcgaaggcgtg
gactggtcgccggtttccattcatggcgaggccatcatcaggcagctgtggcagccaggt
ctgaatcgggcctggaacgtcaactttcccgcctgcgaggcggccgccatcagccgggcc
cggtggtgccgggagtccaacggctccatacagcgcgcccgcctgcaggcgggtcaggat
gcccgcagtctgccgtactggtggctgggatttgatcgcagttcgcgtcacattgtggcg
cccgatgaagacgccagcgtgctgcgggacaaagccatcgccattacgccattacgccac
caggaccgcctgcccggcggcgctgacgtttttgatttggccgcatcagcggcccactga

DBGET integrated database retrieval system