KEGG   Marinobacter sp. CP1: ACP86_15135Help
Entry
ACP86_15135       CDS       T04052                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
mari  Marinobacter sp. CP1
Pathway
mari00471  D-Glutamine and D-glutamate metabolism
mari01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mari00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ACP86_15135
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mari01011]
    ACP86_15135
Enzymes [BR:mari01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     ACP86_15135
Peptidoglycan biosynthesis and degradation proteins [BR:mari01011]
 Precursor biosynthesis
  Racemase
   ACP86_15135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AKV97378
UniProt: A0A0K1UC79
Position
3283667..3284530
Genome map
AA seq 287 aa AA seqDB search
MSRQSPPRVLVFDSGVGGLSVAACIHRQLPGLEIVYLADNAGFPYGDKSEAVVIDRCCSL
ITRALELYPSDAIVVACNTASTVVLPHLRAMTAVPVVGVVPAIKPAAAKSVNRRMGLLAT
PATVRRPYLDRLVEEFAGDCRIERIGHPGLVRWAEDLVSGIEVPLAELSEAMRPFKEAGV
DTVVLGCTHYPLLLESLRASLPTVRFWVDSGEAIARRVAWLLEQTGRLDVAQGPVASAGK
QPVSAALFSGPAPKGTAPFMAGLGLEAKRVSEHWPGEPLGATATGSA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
ttgagcaggcagtcacctccaagggttctggtgtttgactccggtgtcggtggtctgagc
gttgcggcctgcattcaccggcaactgccgggactggagatcgtctatctggcagacaac
gcaggctttccctatggcgacaaatccgaggcggttgtgatcgaccgttgttgcagtctg
atcaccagagcgctcgagctctacccgtcagacgccatcgtggttgcctgcaacaccgcc
agtaccgtggttctgccgcatttacgtgcgatgacggcggtgccggttgtgggggtggtg
ccggccatcaaaccggcggcagcaaagtccgtgaatcggcgaatggggctgctggcgaca
ccggcaacggttcgcaggccttatctcgacaggctggtcgaggaattcgctggcgattgc
aggattgagcgtattggccatccggggctggtgcgctgggcagaggacctggtttccgga
atcgaggttccgcttgccgagctgagcgaagccatgaggccttttaaagaggccggtgtg
gacaccgtggtgcttggttgcactcactatccactgttactggagagtctgagggcgagt
ctgccgacggttcgtttctgggtggactcgggtgaggccattgcccgacgggtagcctgg
ctgctggaacagaccggtcggcttgatgttgctcaaggcccagttgccagcgcagggaaa
caacctgtgagcgctgcgctgttttcagggccggcaccgaagggcaccgcgcccttcatg
gcgggcctggggctggaggccaaacgggtgagcgaacactggccgggagagcctctgggg
gctacagcaaccgggtcagcttga

DBGET integrated database retrieval system