KEGG   Marinobacter sp. CP1: ACP86_17155Help
Entry
ACP86_17155       CDS       T04052                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mari  Marinobacter sp. CP1
Pathway
mari00071  Fatty acid degradation
mari00072  Synthesis and degradation of ketone bodies
mari00280  Valine, leucine and isoleucine degradation
mari00310  Lysine degradation
mari00362  Benzoate degradation
mari00380  Tryptophan metabolism
mari00620  Pyruvate metabolism
mari00630  Glyoxylate and dicarboxylate metabolism
mari00640  Propanoate metabolism
mari00650  Butanoate metabolism
mari00900  Terpenoid backbone biosynthesis
mari01100  Metabolic pathways
mari01110  Biosynthesis of secondary metabolites
mari01120  Microbial metabolism in diverse environments
mari01130  Biosynthesis of antibiotics
mari01200  Carbon metabolism
mari01212  Fatty acid metabolism
mari02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mari00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACP86_17155
   00630 Glyoxylate and dicarboxylate metabolism
    ACP86_17155
   00640 Propanoate metabolism
    ACP86_17155
   00650 Butanoate metabolism
    ACP86_17155
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ACP86_17155
   00072 Synthesis and degradation of ketone bodies
    ACP86_17155
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ACP86_17155
   00310 Lysine degradation
    ACP86_17155
   00380 Tryptophan metabolism
    ACP86_17155
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ACP86_17155
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ACP86_17155
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ACP86_17155
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mari04147]
    ACP86_17155
Enzymes [BR:mari01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ACP86_17155
Exosome [BR:mari04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ACP86_17155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C Dodecin
Motif
Other DBs
NCBI-ProteinID: AKV97737
UniProt: A0A0K1UD96
Position
complement(3730942..3732150)
Genome map
AA seq 402 aa AA seqDB search
MTTEAYIFDAVRTPRGRGKKDGSLHSVKPISLLTTVLHALQERNSLDTAQVDDIVMGCVT
AVGDQGADIAKTAALAADWDEKVGGVTLNRFCASGLEAVNLAAMKVRSGWEDMVVAGGVE
AMSRVPMGSDGGAWATDPETNLHTGFMPQGIGADLIATLEGFSREDVDGFAVKSQQKAAN
AWQNGYFAKSIIPITDQNGVVILDRDEHVRGNTSLESLSGLKPSFQMMGEMGFDGVAREK
YHYVEKINHVHHAGNSSGIVDGATAMLIGSEAKGKAMGLTPRARIIATAVTSTDPTIMLT
GPAPAARKALEKAGMTADQIDLFEVNEAFASVVMRFQRELSVPGEKVNVNGGAIAMGHPL
GATGAMILGTLLDELERRELRYGLATLCVGGGMGIATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgaggcttatatcttcgatgcagtccgcaccccccgggggcgcggaaaaaaa
gacggatcacttcacagcgtcaaacccatctcgctgttgaccacggtgctccatgcgctg
caggagaggaacagcctggataccgcccaggtggacgacattgtgatgggctgcgtaacc
gccgtgggtgaccagggtgcagatatcgccaagacggcagcgctggccgctgactgggat
gaaaaagtggggggcgtcaccctgaaccgtttctgcgcctccggattggaagccgtgaat
ctggcggccatgaaagttcgctctggctgggaagacatggtggttgccggcggcgtggag
gccatgtcccgtgtgcccatgggctccgacggcggagcctgggccacagatccggaaacc
aatctgcataccggtttcatgccccagggcatcggcgcagacctgattgccaccctcgag
ggcttcagccgtgaagacgttgatggctttgccgtgaaatcccagcagaaagcggccaat
gcctggcagaacggctactttgcgaagtccatcattccgatcactgaccagaatggcgtg
gtgatccttgatcgcgatgagcatgtgcgtggcaacacttccctggaaagcctttccggc
ctgaaaccctccttccagatgatgggcgagatgggcttcgacggtgtcgcccgggagaaa
taccactacgtggagaagattaaccacgttcatcatgccggcaactcctcaggtatcgtc
gacggtgccaccgccatgctcatcggcagtgaagccaagggcaaagccatggggctgacg
ccgcgcgctcgcatcatcgccacggccgtgaccagcacagaccccaccatcatgctcacc
ggccccgccccggcagcgcgcaaggcactggaaaaggcgggcatgactgccgatcagatc
gatctgtttgaagtgaacgaggccttcgcctctgtggttatgcgcttccagcgggaactc
tcggttcccggcgaaaaagtgaacgtgaacggcggggctatcgccatgggccacccgctg
ggtgccaccggcgccatgatccttggcaccctgctggatgagctggagcggcgcgagctg
cgctacggcctggccacactgtgcgtcggtggcggcatgggcattgccaccatcattgag
cgcgtctga

DBGET integrated database retrieval system