KEGG   Marinobacter sp. CP1: ACP86_17955Help
Entry
ACP86_17955       CDS       T04052                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
mari  Marinobacter sp. CP1
Pathway
mari00010  Glycolysis / Gluconeogenesis
mari00071  Fatty acid degradation
mari00350  Tyrosine metabolism
mari00625  Chloroalkane and chloroalkene degradation
mari00626  Naphthalene degradation
mari01100  Metabolic pathways
mari01110  Biosynthesis of secondary metabolites
mari01120  Microbial metabolism in diverse environments
mari01130  Biosynthesis of antibiotics
mari01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mari00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACP86_17955
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ACP86_17955
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    ACP86_17955
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ACP86_17955
   00626 Naphthalene degradation
    ACP86_17955
Enzymes [BR:mari01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ACP86_17955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AKV97878
UniProt: A0A0K1UDM6
Position
complement(3908060..3909247)
Genome map
AA seq 395 aa AA seqDB search
MTNKYYEFFCPVKVIAGKAALEHIPYELTGMAAKRPMIVTDKGVRAAGLLEPVIAACEES
GLEITTIYDDVPPDSSTTVVRDIAGIYRQEKCDSIIAVGGGSAIDTGKAVNILVSEGGDD
IAKYSGAGVLKHPLKPFFVVPTTAGTGSEVTSVAVITDEAKGVKLPFTSSFLLPNAAIID
PRMTLTLPPHITAATAMDAMTHATEAFTCMAKNPLSDAYATAAIKKISQSLLQVMDNPKD
SDGRLELAQASTMAGIAFSNSMVGLVHALGHATGAVCHLPHGLCMSLYLPYALEYNLETI
REPLGELLLYLEGPKVFAATPASRRAEASISAIRKLRDALYKRCQLPRTLKETGKVTEAQ
LDHIAEMALDDGSIMFNPKEVTLEDARSVLRRAWA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaccaataaatactatgagttcttctgcccggtaaaagtcattgccggcaaggccgcc
cttgaacacatcccttacgagctgaccggaatggctgccaaacggccaatgatcgtaacc
gacaagggcgtgcgggctgcgggcctcctggaacccgtgatcgcagcttgcgaggaaagc
gggctggaaataaccaccatctatgatgacgttccgcctgactcctcgaccacggtggta
cgcgatatcgccggcatctatcgtcaggaaaagtgcgactccatcatcgccgtgggcggc
ggttcggcgatcgataccggcaaggccgtcaacatcctggtttccgagggtggtgacgat
atcgccaagtacagcggtgccggtgtgctcaagcatccgctcaagcccttcttcgtggtg
ccgacaacagccgggaccggttcggaagttacatcggttgcggtcatcaccgatgaagcc
aagggcgtcaagctgcccttcacgtcgtcgttcctgctgccaaacgcggccatcattgac
ccgcgcatgaccctcaccctgccgccgcacattactgccgccacagccatggacgccatg
acccacgcaaccgaagcgttcacctgcatggcgaaaaacccattgagtgacgcctacgcg
accgcggctatcaagaaaatcagccagtcactccttcaggtcatggacaacccgaaagac
agcgacggacgactggagctggcgcaagcctcgaccatggccggcatcgccttctccaac
tccatggtgggtctggtgcatgccctggggcacgccaccggcgccgtctgccacctgccc
cacggcctctgcatgagtctttacctgccctacgccctggagtacaaccttgaaaccatc
cgggaacccctgggtgaacttttactgtatctcgagggccccaaagtctttgcagcaaca
ccggcaagccgacgggcagaggccagtatttccgcgatccggaagttgcgggatgctttg
tacaagcgctgccagctgccccggacactcaaggaaaccggtaaggtaaccgaggcacag
ctggaccacatcgctgaaatggcgttggatgatggttccataatgtttaatccgaaggaa
gtaacgctggaggatgcccgctcggttctgcgccgcgcctgggcgtga

DBGET integrated database retrieval system