KEGG   Marinobacter sp. JH2: MARI_13240Help
Entry
MARI_13240        CDS       T06162                                 

Gene name
acnD
Definition
(GenBank) 2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
marj  Marinobacter sp. JH2
Pathway
marj00640  Propanoate metabolism
marj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:marj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MARI_13240 (acnD)
Enzymes [BR:marj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     MARI_13240 (acnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: QBM17218
UniProt: A0A4P6WCZ6
Position
complement(1432590..1435214)
Genome map
AA seq 874 aa AA seqDB search
MNTEYRKPLPGTDLKYYDTRQAIEDIQPGSYAKLPYTSKILAEQLVRRCDAETLTDSLKQ
LIERKSELDFPWYPARVVCHDILGQTALVDLAGLRDAIAEKGGDPAKVNPVVPTQLIVDH
SLAVEAAGFDPDAFDKNRAIEERRNEDRFHFINWTRTAFHNVDVIPAGNGIMHQINLEKM
SPVIQNRADEDGHPIAFPDTCVGTDSHTPHIDALGVIAVGVGGLEAETVMLGQPSMMRLP
DIVGVKLTGKRQPGITATDIVLAITEFLRKERVVGAYLEFFGEGASSLTIGDRATISNMT
PEYGATAAMFYIDEQTIDYLKLTGREPEQVDLVEKYAKETGLWATEMTEAQYERVLEFDL
STVVRNVAGPSNPHRRVATSELGDRGIAVNLDKALEEEKKGLMPDGAVIIAAITSCTNTS
NPRNVVAAGLVAKKANELGLVRKPWVKSSFAPGSKVARLYLEEAGLLPEMEKLGFGIVAY
ACTTCNGMSGALDPKIQQEIIDRDLYSTAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYA
IAGTVRFDIEQDALGYDKDGKPVTLKDLWPSDEEIDRIVGEFVKPEQFKEVYIPMFNLDA
VEQAKSPLYDWRSMSTYIRRPPYWEGALAAERTMTGMRPLAVLGDNITTDHLSPSNAIMM
DSAAGEYLHKMGVPEEDFNSYATHRGDHLTAQRATFANPKLLNEMVRDESGEVKQGSFAR
IEPEGQVTRMWEAIETYMERKQPLIIVAGADYGQGSSRDWAAKGVRLAGVEVIVAEGFER
IHRTNLVGMGVLPVQFSEGETRQTYNIDGTETFDMKGEIAPGAELTLVINRKNGESVEVP
VKCRLDTFAELNIYSAGGVLQRFAQDFLEAEGAA
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgaatacagaaaaccccttccgggtaccgatctgaaatactacgacacccgt
caggccatcgaagacattcagcccggctcatacgccaaactgccgtatacctctaaaatt
ttggccgaacaattggttcgtcgttgtgatgccgagacgctcaccgactccttgaaacag
ttgatcgagcgtaagagcgaactagacttcccttggtatccggcgcgcgtggtgtgccac
gacattcttggccagaccgccttggtagacttggccggtctgcgtgacgccattgccgaa
aagggcggcgatcccgctaaagtaaaccccgtggtgccaacccagctgattgtagatcac
tcgctggcggtggaagccgcgggctttgaccccgatgcgttcgataaaaaccgtgccatt
gaagagcgccgcaatgaagaccgttttcacttcattaactggactcgtaccgccttccac
aatgtggatgtgatccccgcgggtaacggcatcatgcatcagatcaacctggagaaaatg
tctccggtgatccagaaccgtgctgatgaagacggccatccgattgctttccctgatacc
tgtgtcggcaccgacagccacaccccacacatcgatgcattgggcgttattgctgtgggt
gtgggcggtttggaagcagagacagtcatgctgggccagccgtctatgatgcgcctgccg
gacatcgtcggtgtgaagctcacgggcaagcgccagccgggcattactgcaaccgacatc
gttctggcgattaccgaatttttgcgtaaggaaagggtagtaggggcgtatcttgagttc
tttggtgaaggtgcttccagcctgaccatcggcgaccgtgccaccatttccaacatgaca
ccggaatatggcgccacggcagcaatgttctacatcgacgagcagaccatcgattatctg
aagcttactggccgggaaccagaacaggttgatctggttgagaagtacgcgaaagaaaca
ggcctgtgggccaccgaaatgacagaagctcagtacgagcgtgtactcgaatttgatttg
tctacggttgttcgtaacgtggctggtccgtcgaacccgcatcgccgtgtcgcaacgtca
gagctgggtgatcgcggtattgcggtgaatttggacaaggctctggaagaagagaagaaa
ggtttgatgccggatggggcagtgatcatcgctgcaatcacatcttgtactaacacctct
aaccctcgcaacgtagtagcggctggtttggtggcgaaaaaagccaacgagctgggcttg
gtgcgtaagccctgggttaaatcttcctttgccccgggctccaaagtggctcgcctgtat
ctggaagaagccggcctactgcccgaaatggaaaaattgggcttcggtatcgtggcctac
gcctgcactacgtgtaacggtatgtctggcgctctggacccgaaaatccagcaggaaatc
attgaccgtgacctgtactcaactgcggtactgtccggcaaccggaacttcgatggccgt
atccacccctatgccaagcaagctttcctagcgtcaccgccgctggttgtggcctatgct
attgccggtaccgtacgcttcgatatcgaacaagacgccttgggttacgacaaagacggc
aagccggtcaccctgaaagacctgtggccttccgatgaagaaatcgaccgcatcgttggc
gagttcgtgaagccggagcagttcaaagaagtctacatcccgatgttcaacctggatgct
gttgagcaggccaagagcccactgtacgactggcgctcgatgtctacctacatccgtcgc
ccgccatactgggaaggtgcgttggctgccgagcgcaccatgacgggtatgcgcccgttg
gccgttttgggtgacaacatcaccacggatcacctgtcgccatctaacgccatcatgatg
gactccgcagccggtgaatacctgcacaaaatgggtgttccggaggaagacttcaactcc
tacgctacgcaccgtggtgatcacctgaccgcgcagcgggctacctttgccaacccgaaa
ctgctgaacgaaatggttcgagatgaaagcggcgaagtgaagcaaggctcgttcgctcgt
attgagccagaagggcaggtcactcgcatgtgggaagcgatcgaaacttacatggaacgc
aagcagccgttgatcatcgtggccggtgcggactacggccaaggctcttcccgtgactgg
gcagccaaaggtgttcgtttggcaggtgtggaggtgattgtcgcggaaggcttcgagcgt
attcaccgtaccaatctggtgggcatgggcgtattgccggttcagttcagtgaaggcgaa
actcgccagacctacaatatcgacgggaccgaaaccttcgatatgaagggcgaaatcgca
ccgggtgcggaactcactctggtgatcaaccgtaaaaacggtgagtccgtcgaagtgccg
gtgaaatgtcgtctggacaccttcgctgagctgaatatctattcggccggcggcgtactt
cagcgcttcgctcaggatttcctggaagccgaaggtgcagcgtaa

DBGET integrated database retrieval system