KEGG   Maribacter sp. 1_2014MBL_MicDiv: YQ22_04765Help
Entry
YQ22_04765        CDS       T04570                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
marm  Maribacter sp. 1_2014MBL_MicDiv
Pathway
marm00360  Phenylalanine metabolism
marm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
marm00790  Folate biosynthesis
marm01100  Metabolic pathways
marm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:marm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    YQ22_04765
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YQ22_04765
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    YQ22_04765
Enzymes [BR:marm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     YQ22_04765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H MIX
Motif
Other DBs
NCBI-ProteinID: APA63684
Position
1163406..1165169
Genome map
AA seq 587 aa AA seqDB search
MGEFSSTYESNPILDKLPSHLRQYIKPQNYEDYTPINQAVWRYVMRKNVDYLSQVAHKSY
TEGLGKTGISIDNIPNMYGMNRILKDLGWAAVAVDGFIPPAAFMEFQAYNVLVIASDIRQ
LENIAYTPAPDIIHEGAGHAPIIANPEYAAYLRRFGEIGCKAISSAKDFELYEAVRHLSI
IKEAKGTPIEEIQKSEKHIEFLQDNMGEPSEMALIRNLHWWTVEYGLIGTLEDPKIYGAG
LLSSIGESQWCMTDNVKKLPYSIEAARTSFDITKPQPQLFVTPDFAFLSQVLEDFANTMA
LRKGGLSGLQKLIDSKELGTIELSTGLQVSGNFESLISHEGKPIYFQTKGKSALAYREKE
LVGQDINQHETGFGSPIGRLKGINIPIEDMSPRDLKAYKIYEGEIVSLDFIGGINVTGKI
VTGTRNLQGRIILITFENCKVTHNGTTLFESNDELYNMAIGEDIVSAYHGPADLHSFDLL
DHSLSPSSVSKNEESLNELESYYKTIRDFREGKNTIVSRTKIFQEIQEKYPTDWLLPVEI
YELAIKSNDDKLVKNIERHLENIKLDQPKLGQLIDDGLALATVKSLA
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaattttcttctacatatgaaagcaatcctattttggataaacttccatcacat
ttaaggcaatacattaaacctcaaaactatgaggattacacccctataaaccaagctgtt
tggagatatgtgatgcgcaaaaatgtagattaccttagccaagttgcccataaatcatat
acggaaggcttaggtaaaacaggcatctccatagacaacatcccaaatatgtatggcatg
aaccgtattttaaaagatttaggctgggccgccgttgctgtagatggctttattccacca
gccgcttttatggagttccaagcctacaatgttctagttatagcttctgatattcgccaa
ttagaaaatattgcctatacccctgccccagatatcattcatgaaggagcgggccatgcg
cctattattgccaaccctgaatatgctgcatatttaaggcgatttggggaaattggttgt
aaggccatatctagtgctaaagattttgaactatacgaagctgtacgccatttatccatt
atcaaagaagctaaaggcacaccaatagaagaaattcaaaagtctgaaaagcatattgaa
tttcttcaggacaatatgggtgaacccagcgaaatggcgcttattagaaacttgcattgg
tggaccgtggaatacggacttataggaaccttagaagaccctaagatttacggagcggga
cttttatcctctattggtgaaagtcagtggtgcatgacagataatgtaaaaaaactgcct
tattccattgaagcggcaagaacctcttttgatatcaccaaacctcaaccacaacttttt
gttactccagattttgcttttttgagtcaggttcttgaagactttgcaaatacaatggct
ttacgaaagggcggactttcaggtttacagaaacttatagactcaaaagaactagggaca
attgaactaagtactggattacaagtatccggtaattttgaatcattgatttctcatgaa
ggcaaacctatatactttcaaaccaagggcaaatctgctttagcataccgagaaaaagag
ttggtagggcaagatatcaatcagcatgaaactggttttggctctcctatcggaaggctt
aagggtattaatatccctattgaagacatgagtccgcgcgaccttaaagcatataagatt
tatgaaggtgaaattgtttcgttagattttattggcggaatcaatgttaccggtaaaata
gttaccggcacacgtaatcttcaaggtagaattatcttaattacttttgaaaattgtaag
gtaacacataatggaacaaccctttttgaatctaacgatgaattgtacaatatggcaatc
ggcgaagacatagtttccgcctaccatggtcctgcagatttgcatagttttgacctttta
gaccattccctaagccctagcagtgtcagcaaaaatgaagaaagtttaaatgaactagaa
tcttattataagacaatcagggattttagagagggcaaaaacaccattgtttctagaaca
aagatttttcaggaaatacaggaaaaatacccaacagattggttattgcctgttgaaatt
tatgaactggccataaaaagtaatgatgacaaattagtaaaaaatatagagcggcacctt
gaaaacattaaacttgaccaaccgaaactagggcaattaattgatgacggactagcatta
gctacggtaaaatccctggcttaa

DBGET integrated database retrieval system