KEGG   Maribacter sp. 1_2014MBL_MicDiv: YQ22_06300Help
Entry
YQ22_06300        CDS       T04570                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
marm  Maribacter sp. 1_2014MBL_MicDiv
Pathway
marm00010  Glycolysis / Gluconeogenesis
marm00020  Citrate cycle (TCA cycle)
marm00620  Pyruvate metabolism
marm01100  Metabolic pathways
marm01110  Biosynthesis of secondary metabolites
marm01120  Microbial metabolism in diverse environments
marm01130  Biosynthesis of antibiotics
marm01200  Carbon metabolism
Module
marm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:marm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YQ22_06300
   00020 Citrate cycle (TCA cycle)
    YQ22_06300
   00620 Pyruvate metabolism
    YQ22_06300
Enzymes [BR:marm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     YQ22_06300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP
Motif
Other DBs
NCBI-ProteinID: APA63955
Position
complement(1539802..1541418)
Genome map
AA seq 538 aa AA seqDB search
MKSSMTNANTISLKNYGITHANFHYQETPEQLQKATLEMDMGVETSNGTLAVKTGEFTGR
SPLDRFIVKDDITKDKVWWGNINIAFEKEKFDALYTKVIDYLNEKELFVRDSYACADEDY
KLNIRVINEYPWSNMFAYNMFLRPTETELEDFTPEWTVINAPGFMADPAVDGTRQHNFAI
LNFTDKIALIGGTGYTGEIKKGIFSALNFILPVYKETLPMHCSSNVGEDGDTAIFFGLSG
TGKTTLSTDPNRKLIGDDEHGWTSRNTVFNFEGGCYAKVINLSEEQEPEIYGAIKPGAIL
ENVVLDDKGNVDFSDTSITQNTRVSYPIHHIDNIQQPSIGKNVKNIFFLTADAFGVLPPI
SKLTPSQAAYHFISGYTAKVAGTEAGVVEPVPSFSACFGAPFMPLHPTKYAEMLSKKMKE
SGVDVWLVNTGWTGGPYGVGTRMKLKYTRAMISAALSGELGLYSYDKYHIHSVFGVAQPR
ECPGVPTSVLSPRATWNDDEKYYTTAFKLTNAFRENFKKFESYASEEIRRGGPQRYAF
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagctcaatgacaaatgcgaataccatatccctaaaaaattatgggattacacac
gccaattttcattatcaagaaacccctgaacagcttcaaaaagcaactctggaaatggac
atgggagttgaaaccagtaatggaacacttgcggtcaaaaccggtgaatttacaggtagg
tctcctttggatagatttatagttaaagatgatatcacaaaagataaggtctggtggggt
aatatcaatattgcatttgaaaaagaaaaatttgatgcactatatactaaggtaatagac
tatttaaacgaaaaagaactttttgttagagatagttatgcttgtgcagatgaagattat
aaattgaatataagggtcattaatgagtatccttggtctaatatgtttgcgtataatatg
tttttacgaccaaccgagaccgaattggaagattttactccggaatggacggtaatcaat
gcacctggctttatggcagatcctgctgttgatggtacaagacaacataactttgctatt
ttaaatttcaccgataaaattgctttgatcggtggtacgggttatacgggtgagattaaa
aaaggaattttctctgcattgaactttattttaccggtatataaagaaacattgccaatg
cattgctcgtcaaatgttggtgaggatggtgatacagcaatcttttttggactatcaggc
acgggtaaaacaaccttgtcaactgatcccaatagaaaactaataggtgatgatgaacac
ggttggaccagtagaaataccgtttttaattttgaaggcggttgttatgccaaggtcatt
aacttgtctgaagagcaagagccagaaatttatggtgccattaagccaggggcaattctg
gaaaatgtggttttagatgataagggtaatgttgatttttcagatacttcaattactcaa
aatacaagggtgagttatccaattcatcatattgataatattcagcagccatcaattggt
aagaatgtgaagaatattttctttttgactgctgatgcttttggtgtgctacctccaata
tctaaattaactcctagtcaagctgcataccactttatttctggttatacggcaaaggtg
gcaggtacagaagctggtgttgtagagccggtaccatcattttctgcatgttttggagct
ccgtttatgcctttgcacccaactaagtatgcagaaatgctaagtaagaaaatgaaagag
tctggtgtagatgtatggctagtaaatacgggttggacaggtggtccatatggagtggga
actcgaatgaaattaaagtatacaagagcaatgatctcagctgccttaagtggagagtta
ggtctttattcttatgataaataccatatacattcagtattcggtgttgcgcagccaagg
gagtgtcctggggtaccaacatcggttttgagtcctagagctacttggaacgatgatgaa
aaatattacaccactgcgtttaagttaacaaatgcttttagggaaaactttaaaaagttt
gaaagttatgccagtgaagaaataagaaggggcggaccacaacggtacgcgttttag

DBGET integrated database retrieval system