KEGG   Maribacter sp. 1_2014MBL_MicDiv: YQ22_15325Help
Entry
YQ22_15325        CDS       T04570                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
marm  Maribacter sp. 1_2014MBL_MicDiv
Pathway
marm00260  Glycine, serine and threonine metabolism
marm01100  Metabolic pathways
marm01110  Biosynthesis of secondary metabolites
marm01120  Microbial metabolism in diverse environments
marm01130  Biosynthesis of antibiotics
marm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:marm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YQ22_15325
Enzymes [BR:marm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     YQ22_15325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Cys_Met_Meta_PP Aminotran_3 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: APA65563
Position
3662333..3663355
Genome map
AA seq 340 aa AA seqDB search
MLINLISDTVTKPTPGMLDAMMTAEVGDDVFKEDPTVNALEEKVAKLFGMESALFFPSGT
MTNQTAIKLHTQPGEQLICDKYAHIYNYEGGGVSFNSGVSCRLVDGDRGTMTAEQVAVAI
NPPDFYHSPLTTLVSIENTANKGGGTCWNFSELQAIKKVCANNGLKYHLDGARLWNALVE
MEETPLQYGELFDTISVCLSKGLGCPVGSLLLGTQEQMNKAIRIRKIFGGGMRQSGFLAA
AAIYALDNHIERLAEDHKKAKEIGAALAAKSFIKKVEPIETNIVIFEIDESFMTSDQFVH
KLKEKNILIIGMGQGKLRMVTHLDYTNDMHEELLKQLASF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcttattaatcttatcagtgatacggtaaccaagcctacacccggaatgttagatgct
atgatgaccgctgaggtgggtgatgatgtttttaaagaggatcctaccgtaaatgcctta
gaggaaaaggtggcaaaactttttggaatggagtcagcactgttttttcctagtggtacc
atgaccaaccagaccgctataaaattacatacgcagcctggtgagcaattgatctgtgac
aagtatgcccacatttataattatgaaggtggtggtgttagttttaatagtggggtgtct
tgcagactggtagatggtgataggggtacaatgacagcggaacaagtggcagtggcaata
aatccaccggatttttaccatagcccgttaaccacattggtatccatagaaaatacagca
aataaaggtgggggtacttgttggaattttagtgaactgcaggcaattaaaaaggtttgt
gctaataatggtttaaagtatcatttagatggagcaagattatggaacgctttggttgaa
atggaagagactccgttgcagtacggagagctttttgataccataagcgtctgtttgagt
aaagggctaggttgccctgtagggtctttgctattgggtactcaagaacaaatgaacaag
gcgatccgtattcgtaaaatatttggtggtggcatgagacaatcggggtttttggcggca
gcggctatttatgctttggacaatcatatagagagattggcagaagatcataaaaaggca
aaggaaataggagcggcattagccgcaaaatcttttataaaaaaggtagagcctattgaa
accaatattgtcatttttgaaattgatgagtcatttatgacaagcgatcaatttgttcat
aaattaaaagaaaagaatattttaataattggtatggggcaggggaaattgagaatggtt
acccatttggactatactaatgatatgcatgaagaattgcttaagcagctagcgtctttt
taa

DBGET integrated database retrieval system