KEGG   Marinitoga sp. 1137: LN42_08185
Entry
LN42_08185        CDS       T04633                                 

Definition
(GenBank) ornithine aminomutase
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
marn  Marinitoga sp. 1137
Pathway
marn00472  D-Arginine and D-ornithine metabolism
marn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:marn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    LN42_08185
Enzymes [BR:marn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     LN42_08185
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A
Other DBs
NCBI-ProteinID: APT76359
Position
1672597..1672968
AA seq 123 aa
MEPRKSDFEERAKHLMNMSDEELDKYFWDLVEKVVDPLIELASTHTSPSVERSVLLRMGF
NSMEAKALVDKFFEKNILGKGAGNIVYTIAKEHNIDYIQAGRDLIAGKYWDDVDRIFIHG
GDK
NT seq 372 nt   +upstreamnt  +downstreamnt
atggaaccaagaaaatcagattttgaagaaagagcaaaacatttaatgaatatgtccgat
gaggaattagataaatatttctgggatcttgttgaaaaagtagtagatcctctaattgaa
ttagcttcaacacatacatcaccatctgttgaaagatctgtattattgagaatgggtttt
aacagtatggaagcaaaagcattagttgataaattctttgaaaagaatatacttggcaaa
ggtgctggaaatattgtatatacaatagccaaagaacataatattgattatatacaggca
ggaagagacttaattgcaggaaaatactgggacgatgtggatagaatttttattcatgga
ggcgataaatga

DBGET integrated database retrieval system