KEGG   Marinilactibacillus sp. 15R: BKP56_01810Help
Entry
BKP56_01810       CDS       T04573                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
marr  Marinilactibacillus sp. 15R
Pathway
marr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:marr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BKP56_01810
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:marr03011]
    BKP56_01810
Ribosome [BR:marr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BKP56_01810
  Bacteria
    BKP56_01810
  Archaea
    BKP56_01810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: API88138
UniProt: A0A1L4BWB4
Position
complement(383128..383484)
Genome map
AA seq 118 aa AA seqDB search
MAETVTAAKATARTVRIAPRKARLVVDTIRGKSAAEAISILRFTNRGASEEVEKVLMSAI
ANAEHNYDMDIEELYVSEAYVNEGATLKRFRPRAKGAASRINKRTSHITVVVSEKKEG
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaacagtaacagcagcaaaagcaactgcgcgtacagttcgtattgctcctcgt
aaagctagattagtagtcgatactatccgaggaaaaagtgctgcagaagctatttctatc
cttcgcttcactaacagaggagcatctgaagaggtagaaaaagttttaatgtcagcaatt
gcgaatgctgaacataactatgatatggatattgaagaattatacgtaagcgaagcctat
gtaaacgaaggagctactttaaaaagattccgtccgcgtgcaaaaggtgcagcttcaaga
atcaacaaacgtacaagccacattactgtagtggtatcagagaagaaggaggggtaa

DBGET integrated database retrieval system