KEGG   Marinilactibacillus sp. 15R: BKP56_01965Help
Entry
BKP56_01965       CDS       T04573                                 

Definition
(GenBank) cysteine--tRNA ligase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
marr  Marinilactibacillus sp. 15R
Pathway
marr00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:marr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BKP56_01965
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:marr01007]
    BKP56_01965
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:marr03016]
    BKP56_01965
Enzymes [BR:marr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     BKP56_01965
Amino acid related enzymes [BR:marr01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   BKP56_01965
Transfer RNA biogenesis [BR:marr03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BKP56_01965
 Prokaryotic Type
    BKP56_01965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1f DALR_2 tRNA-synt_1 tRNA-synt_1d DUF745 CCDC53 UVR
Motif
Other DBs
NCBI-ProteinID: API88166
UniProt: A0A1L4BWE6
Position
complement(416309..417733)
Genome map
AA seq 474 aa AA seqDB search
MIELYNTLSNKKEVFKPIEDGKVKMYVCGPTVYNYIHIGNSRSTIAFDTVRRYFEYRGYE
VNYVSNFTDVDDKIIRAARELGITAPEVADRFIKAYYEDTEALHVKKPTHTPRVMENIQD
IMHFVEQLIAKEFAYAVDGDVYYRTRKFAGYGKLSGISVDELESGASKRLEEIESSKKED
PLDFALWKSVKGDEISWASPWGEGRPGWHIECSVMATKYLGDTIDIHAGGHDLTFPHHEN
EIAQSEAKTGKPFAHYWMHNGFVTMDEEKMSKSLGNFVLVNELRMIHDPQVLRFFMATVH
YRHPISYTEDTIQEAKTNLNKIQTAYANASHRLNTAVDALDGDEVHISQWVQMVNQFKQH
MDDDFQAQNGITDVYEMVRMLNRYLKAPEVSKVVVNYAMEQLEAILDIFGIQLKATDDNN
LLDEEIESLIEERNQARSEKNFSRADEIRNILQEKGIILEDTPQGIRWKRKDRL
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgattgagttgtacaatacgctatcaaataaaaaggaagtttttaaaccgatcgaagat
ggaaaagtgaaaatgtatgtatgtggaccgacagtctataattacattcacatcggaaat
tctagaagtacgattgcatttgatacggtcagacgttattttgagtatcgtggatatgaa
gtaaattatgtgtcaaattttactgatgtagacgataaaattatcagagcagccagagaa
cttggaattactgctccagaagtagcagatcgatttatcaaagcttattatgaagacact
gaagcgctgcacgtcaaaaaacctacacatacacctagagtgatggaaaatattcaggat
attatgcatttcgttgaacaattgattgcgaaagaatttgcatacgctgttgacggagac
gtatattatagaacacgaaaatttgctggatatggaaaactaagtggaatatcagtagat
gaattagagtctggagcaagtaagcgtttggaagaaatagaaagtagtaaaaaagaagat
cctttagattttgccttatggaaatcagtcaaaggagatgaaatcagttgggcttcgcca
tggggagaaggacgcccgggctggcacatcgagtgttcagtcatggcaactaagtatttg
ggagatacgattgacatccatgctggtggacacgatttgacattccctcaccatgaaaat
gaaatagcccaatcagaagcaaagacgggtaaaccatttgcacattattggatgcacaat
ggttttgtaacaatggatgaagaaaagatgagtaaatcgctggggaattttgtactggtg
aatgaattgagaatgattcatgatccccaagtcttacgtttctttatggcaactgttcat
tatcgtcatccaatcagctatacagaagatacaattcaagaagctaaaactaacttaaat
aaaatacagacggcttatgcgaatgcaagtcaccgtctgaatacggctgtagatgcattg
gatggagacgaagttcacataagccaatgggttcaaatggtcaatcagtttaaacaacat
atggatgatgattttcaggctcaaaacggaattacagatgtttatgaaatggtcaggatg
ttaaatcgttatttgaaagcccctgaagtttcaaaagttgttgtgaactatgcgatggaa
caactggaagccattcttgatatatttggaatacaattgaaggcgacggatgataataat
ctattagacgaagaaattgaatcacttattgaagaaagaaaccaagcaagaagcgagaaa
aacttttcacgagcagatgaaattagaaatatcttgcaagaaaaggggattatacttgaa
gatacacctcaaggtattcgctggaaaagaaaggatagactatga

DBGET integrated database retrieval system