KEGG   Marinilactibacillus sp. 15R: BKP56_03620Help
Entry
BKP56_03620       CDS       T04573                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
marr  Marinilactibacillus sp. 15R
Pathway
marr00072  Synthesis and degradation of ketone bodies
marr00280  Valine, leucine and isoleucine degradation
marr00650  Butanoate metabolism
marr00900  Terpenoid backbone biosynthesis
marr01100  Metabolic pathways
marr01110  Biosynthesis of secondary metabolites
marr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:marr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BKP56_03620
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BKP56_03620
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BKP56_03620
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BKP56_03620
Enzymes [BR:marr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     BKP56_03620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III Chal_sti_synt_N Thiolase_N
Motif
Other DBs
NCBI-ProteinID: API88443
UniProt: A0A1L4BX81
Position
745025..746191
Genome map
AA seq 388 aa AA seqDB search
MEIGIDKIGFYTPDVYIDMEKLAEARGVEPAKYTIGIGQEKMAVAPLSQDAVSMAANAAL
EVLDEEDRDAIDFVLFGTESGVDHSKSGAVWVHHLTGIQKYARSVELKQACYSATAAIKM
AMGHISLHPESKVLVLGTDIAKYGLNTGGEPTQGAGAVAMVLSANPKILAIDTDSVSMTE
DISDFWRPLYSDYAYVDGKFSNQAYLNFLTDVWGQYKERNNRDLSDFEALCFHVPYTKMG
KKALKALTENASEEDTARLMGYYEPSVSYNKQVGNIYTGSLYLSLLSLLEQGPLLADNAR
IGLFSYGSGAVGEFFSGIVKPGYKEHMLKEEHEALLNKRRELSIKEYEEILQQSLPKDET
DIELDSEASSGTVILSGVQANIRKYSKK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
ttggaaattggaattgataaaatagggttttatacaccggatgtatatatagatatggaa
aagttagctgaagctagaggagtggaaccagctaaatatacgattggaatcggacaagaa
aaaatggcagtagcgcctttgtcacaagatgcagtatcaatggcagccaatgcagcgctt
gaagtgttagatgaagaagatagagatgcaattgattttgtcttgtttggaacagaatca
ggggtagatcactcaaaatcaggtgcagtttgggtccatcatttaacgggtattcaaaaa
tatgctcgttcagttgaattaaaacaagcttgttatagtgctactgccgcaatcaagatg
gctatgggtcatatttcattgcatcctgaaagcaaagtccttgtattgggaacagatatt
gcaaaatatggactcaatactggtggagagccgactcaaggagcaggagctgttgcaatg
gtattgtctgctaatccgaaaatcctagcaattgatacagatagtgtatccatgacagaa
gacatttccgatttctggcgtccgttatattctgattatgcttatgtagatggaaaattc
tctaaccaagcttatttaaacttcctaacagatgtctggggtcaatacaaagaaagaaat
aaccgtgatttaagtgactttgaagcattgtgcttccatgttccttatactaaaatgggt
aaaaaagcattaaaagctttaacagaaaatgcttcagaagaagatacagctcgtctgatg
ggatattatgagccaagtgtttcttacaataagcaagttgggaatatttatactggatca
ctttatttaagtttgctttctttactggaacaaggaccgttgctagcagataatgcgcgt
attggtctgttcagttatggctcaggagctgttggtgagtttttcagtggaattgtaaaa
cctgggtataaagaacacatgttgaaagaagaacatgaagcattactgaataagcgtcgc
gaattatctattaaagaatatgaagaaattttacagcaatctttacctaaagatgaaaca
gatattgaactggatagtgaagcatctagtggaacggttatcttaagtggggttcaggct
aatattcgcaaatatagtaaaaagtaa

DBGET integrated database retrieval system