KEGG   Marinilactibacillus sp. 15R: BKP56_04240Help
Entry
BKP56_04240       CDS       T04573                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase (decarboxylating)
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
marr  Marinilactibacillus sp. 15R
Pathway
marr00030  Pentose phosphate pathway
marr00480  Glutathione metabolism
marr01100  Metabolic pathways
marr01110  Biosynthesis of secondary metabolites
marr01120  Microbial metabolism in diverse environments
marr01130  Biosynthesis of antibiotics
marr01200  Carbon metabolism
Module
marr_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
marr_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:marr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BKP56_04240
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BKP56_04240
Enzymes [BR:marr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     BKP56_04240
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     BKP56_04240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 6PGD TrkA_N F420_oxidored NAD_binding_11 2-Hacid_dh_C 3HCDH_N IlvN UDPG_MGDP_dh_N LpxI_N
Motif
Other DBs
NCBI-ProteinID: API88556
UniProt: A0A1L4BXH5
Position
880057..880953
Genome map
AA seq 298 aa AA seqDB search
MKLAILGLGKMGFNLMQNLLDHKHEVVAFDIDHNLVEQAEAVGAKGVTSIQKVFKQLDGK
KIIWMMVPAGEITEKLIVDLKPYLSEEDILIDGGNSNYKDTVKRYHDLKNKGISYIDVGT
SGGMEGAREGACTMIGGDKEVFDQIEPIFKDISVENGYLYTGESGSGHFLKMVHNGVEYG
MMQAMSEGFDILEKSTYDFDHEKVARVWNNGSVIRSWLMELMESAFSEDPKLDKIRGIVH
ASGEGKWTVETALELETAAPVIALSLMMRNRSLESNSFSGKVVASLRNQFGGHAVEKQ
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagcaattttaggacttggaaaaatgggatttaatctaatgcagaatttgtta
gaccacaaacatgaagtggtagcttttgatattgatcataatttagttgagcaagctgaa
gcagtaggtgcaaaaggtgtaacgagtattcaaaaagtatttaaacaattggatggcaaa
aaaattatttggatgatggttcctgcaggagaaattaccgaaaaattgatagttgatttg
aaaccgtatctatctgaagaagatattctgatagacggtggaaacagtaactataaagat
actgttaaacgatatcatgatttaaaaaataaaggtatatcttatattgatgttggtaca
agtgggggaatggaaggagcaagagaaggggcttgtaccatgattggtggagataaagaa
gtattcgatcagatagaacctattttcaaagacatttctgtagaaaatggatatttgtat
acaggtgaatctggaagtggtcatttcttgaagatggttcataatggagtagaatatggg
atgatgcaagcaatgagcgaagggttcgatattctggaaaagagtacgtatgattttgat
cacgaaaaagtagcgcgagtctggaataatggttcggttatacggtcttggttgatggaa
cttatggagtctgctttttctgaagatcctaaattagataaaattagaggaatcgttcat
gcttccggagaaggaaaatggacagtagaaacagcattggaattagagactgctgcgcct
gttattgctttatctttgatgatgagaaatcgctctttagaaagcaattcttttagtgga
aaagttgttgcctctttaagaaatcagtttggaggacatgcagttgaaaagcagtga

DBGET integrated database retrieval system