KEGG   Marinilactibacillus sp. 15R: BKP56_10070Help
Entry
BKP56_10070       CDS       T04573                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
marr  Marinilactibacillus sp. 15R
Pathway
marr00030  Pentose phosphate pathway
marr00480  Glutathione metabolism
marr01100  Metabolic pathways
marr01110  Biosynthesis of secondary metabolites
marr01120  Microbial metabolism in diverse environments
marr01130  Biosynthesis of antibiotics
marr01200  Carbon metabolism
Module
marr_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
marr_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:marr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BKP56_10070
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BKP56_10070
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:marr04147]
    BKP56_10070
Enzymes [BR:marr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BKP56_10070
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     BKP56_10070
Exosome [BR:marr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BKP56_10070
  Exosomal proteins of colorectal cancer cells
   BKP56_10070
  Exosomal proteins of bladder cancer cells
   BKP56_10070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: API89581
UniProt: A0A1L4C0F2
Position
2044087..2045556
Genome map
AA seq 489 aa AA seqDB search
MNQANKALFIIFGGTGDLAQRKLYPSLYRLYTKGFLKENFAVIGTARREWSDAHYQEVVR
DSIHSLKVSDEHALEFSSHFYYQAHNVKDTEHYNTLKKLADQLDGKYQIDGNRIFYLSMS
PTFFGTITKHLKSQNLVTENGFNRVIIEKPFGTDYESSKALNDEILEAFESDELYRIDHY
LGKEMVQNILTFRFANPMIESVWNNQFISNMQITLSEELGVEERAEYYDKSGALRDMIQN
HIMQIFSLLTMDAPKSLSTNEVRKQKMLVLSALKELTTETVQSDFVRGQYTRSLDNKLCG
YREEEKVADDSTTETYVAGKLELNNERWNGVPVYIRTGKKLAKKEAQINIVFKQIESSLF
SKGDTAPNILTIYLGPSEGFSITLNEKKIGLGMDTDIMQFDHLRTESMIQESPEAYEKLL
LDCLNGDRTHFAHWEEVAASWKFVDKIRTTWDASTNKLATYPAGTAGPEAANNLLEKNGH
KWIWNPDQH
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagctaacaaagcactttttataatatttggaggtactggtgatctcgcacaa
cgcaaattgtatccttcattgtatcgtttatatacaaaaggcttcttaaaagaaaatttt
gcagtgattggtactgcaagacgtgagtggtcagatgctcactatcaggaagttgttcgt
gactctattcactctttaaaagtttctgatgaacatgccttagagttttcaagtcacttc
tattatcaagctcataatgtcaaggacacagaacactataatacgcttaaaaagttagct
gatcaattagatggtaaatatcaaattgatggtaatagaattttttatctttctatgtca
cctacttttttcggaacgataacaaaacatctgaaaagtcagaatttagtaacagaaaat
ggatttaatcgagttatcattgaaaaaccatttggaactgattatgaaagctctaaagct
ttgaacgatgaaattttagaagcttttgagtctgatgaactttaccgtatcgatcattat
ttaggcaaagaaatggttcaaaatattctaacattcagatttgctaatccaatgattgaa
tcggtgtggaataatcagtttatttctaatatgcagattactttgagtgaagaactgggt
gtagaagagcgtgcagaatactatgataaaagcggagctttaagagatatgatacaaaac
catatcatgcagattttcagtttgctgacaatggatgcaccgaaatcgttgagtactaat
gaagtgcgcaaacaaaaaatgctcgttttatcagcacttaaagaacttactactgagaca
gttcaaagtgattttgttcgtggtcagtatactcgatcattggataataaattatgtgga
taccgtgaagaagaaaaagttgcagatgattctacaaccgaaacttatgtagctggtaaa
ttggaacttaacaatgagcgttggaatggtgtacccgtttatatacgtacaggtaaaaaa
ctggcgaaaaaagaggcacagattaacatcgtcttcaagcaaatagaaagttcgcttttc
agtaaaggggatactgctccaaatattttaacgatctatttaggaccaagcgaaggcttc
tcgatcacattaaatgaaaagaaaatcgggttaggaatggatacagatatcatgcagttc
gatcatctgagaacagaaagtatgatacaggaaagtcctgaagcatatgaaaagcttctt
ctggattgtttaaatggtgatagaactcattttgctcattgggaagaagtagctgcttca
tggaagtttgttgataaaatcagaacaacatgggatgcttctactaataagttagctacc
taccctgcaggtactgcaggtcctgaagcagccaataatttactggaaaaaaatggacat
aaatggatttggaatccagatcaacactga

DBGET integrated database retrieval system