KEGG   Marinobacterium aestuarii: A8C75_03495Help
Entry
A8C75_03495       CDS       T04398                                 

Definition
(GenBank) oxaloacetate decarboxylase subunit alpha
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
mars  Marinobacterium aestuarii
Pathway
mars00620  Pyruvate metabolism
mars01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mars00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A8C75_03495
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mars02000]
    A8C75_03495
Enzymes [BR:mars01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     A8C75_03495
Transporters [BR:mars02000]
 Other transporters
  Primary active transporters [TC:3]
   A8C75_03495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 DUF2118 GCV_H
Motif
Other DBs
NCBI-ProteinID: ANG61628
UniProt: A0A1A9EVD8
Position
795584..797368
Genome map
AA seq 594 aa AA seqDB search
MSDAKKPLGITELVLRDGHQSLLATRMRLDDMLPIADKLDQVGYWSTESWGGATFDSCIR
YIGEDPWDRIRELKKAMPNTRQQMLLRGQNLLGYRHYADDVVARFVERAATNGVDVFRIF
DAMNDPRNLAAAIKAVKATGKHAQGTLSYTTSSVHTLDNWVDYAKTLEDMGAESICIKDM
SGILKPYEAFDLVSRLKNQTQLEVQLQSHATSGLADMTLLKAIEAGIDRVDTSISSMSMT
YGHTATETVVATLDGTDRDTGLNLELLEEIAAYFRDVRKKYAKFEGSLRGTDSRILIAQV
PGGMLTNMESQLREQGAADKFDEVLAEIPRVRADLGLIPLVTPTSQIVGTQAVINVLMGE
RYKSISKEVQAILKGEYGAAPAPYNAELQARVLDGKDPITCRPADMLEPEIERLTVELRK
QAQEKGISLATGDNEIDDVLTYALFPQIGLKFLENRANPDAFEPVPTLEDAQTMAAPKKS
GPEVYTITVNGQNYVVQVAEGGDISAISKAPVAAAAPAAPTVAEGEDVPAPLAGNIWKVE
VGVGQAVQEGDVLVILEAMKMETEVRAARAGTVVAVDVKEGDAVQVGDALLSLA
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatgcaaagaaacccttaggcattaccgaactggtactgcgtgatggtcaccag
tctctgctggccacccgcatgcgcctggacgacatgctccctattgccgacaaactcgat
caggtcggctattggtctacggaaagctggggtggtgccacctttgactcctgcattcgc
tatattggcgaagatccgtgggaccgcatccgcgaactgaaaaaggccatgccgaacacc
cgccagcagatgctgctgcgcggccagaacctgctgggctaccgccactacgccgacgat
gtggttgcccgctttgttgagcgtgctgccaccaatggcgtcgacgtattccgcatcttt
gatgcgatgaacgatccgcgcaacctggccgctgccatcaaggccgtcaaggcgaccggc
aagcatgcccagggcaccctctcctataccaccagctctgttcacaccctggacaactgg
gtggattacgccaagaccctggaagacatgggtgcggaatccatctgtatcaaggacatg
tccggcatcctcaagccctacgaggcgtttgacctggtatcgcgcctgaagaaccagact
cagctcgaagttcagctgcagtcccatgccacctctggcctggcagacatgacgctgctc
aaggccattgaagcgggcatcgaccgcgttgatacctccatttcctccatgtccatgacc
tatggccacaccgcgactgaaaccgtggtggctaccctggacggtactgaccgtgatacc
ggtctgaacctggagctgctggaagaaatcgccgcctacttccgcgacgtacgcaagaag
tacgcgaagtttgaaggctccctgcgcggcacagattcgcgcatcctgattgcccaggtg
cccggtggcatgctgaccaacatggaaagccagctgcgcgagcagggcgctgccgacaag
tttgacgaagtactggccgagattccgcgcgtgcgcgcagatctgggtctgatcccgctg
gttacgcccacctcgcagatcgtgggcacccaggcggtcatcaacgtcctgatgggcgag
cgttacaagagcatttccaaggaagtgcaggccatcctcaagggtgagtacggtgccgct
cctgcgccttacaacgccgagctgcaggcccgtgtactggatggcaaggaccccattacc
tgccgtccggccgacatgcttgagcccgagattgaaaggctgaccgttgagctgcgcaag
caggcccaggaaaaaggcattagcctggcgacgggcgacaacgaaattgatgatgttctg
acctacgccctgttcccgcagattgggcttaaattcctggaaaatcgcgccaaccccgac
gcatttgaaccagtaccgactctagaggacgctcagaccatggctgcaccgaagaaatcc
ggcccggaagtttacaccatcaccgttaacggccagaactacgtggtccaggtcgctgaa
ggtggtgacatctccgcaatctccaaggctccggtcgctgctgctgcgcctgccgctccg
actgttgctgagggtgaagacgtgcccgcaccgctggccggcaacatctggaaagtggaa
gtgggtgtgggtcaggccgtgcaggaaggtgacgtgctggtgatcctcgaagccatgaag
atggaaaccgaagtccgcgccgcccgcgccggaaccgtggttgccgtcgacgtgaaggaa
ggcgatgccgttcaggtgggtgatgccctcctgagcctggcgtaa

DBGET integrated database retrieval system