KEGG   Marinobacterium aestuarii: A8C75_10520Help
Entry
A8C75_10520       CDS       T04398                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mars  Marinobacterium aestuarii
Pathway
mars00071  Fatty acid degradation
mars00072  Synthesis and degradation of ketone bodies
mars00280  Valine, leucine and isoleucine degradation
mars00310  Lysine degradation
mars00362  Benzoate degradation
mars00380  Tryptophan metabolism
mars00620  Pyruvate metabolism
mars00630  Glyoxylate and dicarboxylate metabolism
mars00640  Propanoate metabolism
mars00650  Butanoate metabolism
mars00900  Terpenoid backbone biosynthesis
mars01100  Metabolic pathways
mars01110  Biosynthesis of secondary metabolites
mars01120  Microbial metabolism in diverse environments
mars01130  Biosynthesis of antibiotics
mars01200  Carbon metabolism
mars01212  Fatty acid metabolism
mars02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mars00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A8C75_10520
   00630 Glyoxylate and dicarboxylate metabolism
    A8C75_10520
   00640 Propanoate metabolism
    A8C75_10520
   00650 Butanoate metabolism
    A8C75_10520
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A8C75_10520
   00072 Synthesis and degradation of ketone bodies
    A8C75_10520
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A8C75_10520
   00310 Lysine degradation
    A8C75_10520
   00380 Tryptophan metabolism
    A8C75_10520
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A8C75_10520
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A8C75_10520
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A8C75_10520
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mars04147]
    A8C75_10520
Enzymes [BR:mars01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A8C75_10520
Exosome [BR:mars04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A8C75_10520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Ketoacyl-synt_C
Motif
Other DBs
NCBI-ProteinID: ANG62874
UniProt: A0A1A9EXJ7
Position
complement(2389388..2390569)
Genome map
AA seq 393 aa AA seqDB search
MSHDVVVLSATRSGIGTFGGGLSQIEPAELAGQVMKAAVERSKVDPQQINYVTAGHCIPT
DSRFAYVARVASIQAGLPMESVAMAVNRLCSSGLQAIVSTSQSIMLGDCDYGIGGGVEVM
SRSGYLSPAMRSGARMGDTAMIDMMVATLNDPFGVGHMGITAENLAEKWNLSREDQDAVA
VESHRRAAQAIEEGRFKSQIVPVTLTSRRGDTIFETDEHVKPGTSLESLAKMRPAFKKDG
SVTAGNASGLNDGAAFMVLANAETAAKAGQTPLARLVSYAVAGVPNHIMGEGPIPASLLA
LKKAGLNLSQMDVIESNEAFAAQALAVAKGLELDPAKTNPNGGAIALGHPIGCSGAFIAT
KAIYELHRTNGKYALVTMCIGGGQGIAVIFERL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatgatgttgttgtactaagtgctacccgctccggcatcggcacctttggtggc
ggcctgagccagatcgagcctgcggaactggccggccaggtaatgaaggcggcggtagag
cgctccaaagtggacccgcagcagatcaactatgtcaccgccggacactgcattcccacc
gattcgcgcttcgcctatgtggcccgtgtcgcctccattcaggccggcctgccgatggag
tccgtcgccatggcggtgaaccgcctgtgcagctccggcctgcaggccatcgtctccacc
tcgcaatcgatcatgctgggcgactgtgactacggcatcggcggcggtgttgaagtcatg
tcccgttccggctacctgtcgccggcaatgcgctcgggtgcgcgcatgggcgataccgcc
atgattgacatgatggtggcgaccctcaacgatccctttggcgtcggccatatgggcatt
accgccgagaacctggcggaaaaatggaacctgagccgggaagaccaggatgccgtggcc
gtggaatcccaccgccgtgccgcccaggccatcgaggaaggccgcttcaagtcccagatc
gtgccggtgacgctgacaagccgcaggggcgataccattttcgagaccgacgaacacgtc
aagcctggcaccagcctggaatccctggccaagatgcgcccggcgttcaagaaggacggt
agcgtcaccgccggcaacgcctcaggcctgaatgatggcgccgccttcatggtgctggcc
aatgccgaaacggccgccaaagccggacagacacccctggcgcggctggtatcctacgcc
gtggccggcgtgcccaaccacatcatgggtgaaggcccgattccggcctccctgctggca
ctgaaaaaggccggcctgaacctcagccagatggatgtgatcgagtccaacgaagccttc
gccgcccaggccctggccgtggccaagggactggaactggatcctgccaaaaccaacccc
aacggcggcgccatcgccctgggtcaccccatcggctgctccggcgcttttatcgcaacc
aaggcgatttatgagcttcaccgtaccaatggcaaatacgctctggtgaccatgtgcatc
ggcggtggtcagggtatcgcagtgatattcgaacggctctga

DBGET integrated database retrieval system