KEGG   Marinobacterium aestuarii: A8C75_18920Help
Entry
A8C75_18920       CDS       T04398                                 

Definition
(GenBank) NAD-dependent dehydratase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
mars  Marinobacterium aestuarii
Pathway
mars00053  Ascorbate and aldarate metabolism
mars01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mars00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    A8C75_18920
Enzymes [BR:mars01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     A8C75_18920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_4 RmlD_sub_bind NAD_binding_10 Polysacc_synt_2 zf-C2HC
Motif
Other DBs
NCBI-ProteinID: ANG64342
UniProt: A0A1A9F2L8
Position
4325471..4326274
Genome map
AA seq 267 aa AA seqDB search
MLKRLLITGAAGGLGQLARENLGDLAQHLRLSDISPLQATSPQEEIMCGDLSDAAFVSQL
VEGCDGILHLGGVSVENHFEAILSANIIGVHNLYSAAQQHGQPRILFASSNHTIGFHSPS
TRLDASSVTRPDSYYGVSKCFGEAVASLYYDKLGQETAIVRIGSCFPEPQDVRMLSTWFS
PDDFLALIRRVFTIDTLGCPVIYGVSANRDAWWDNHEIDHLGWKPKDSSEAYRAQVEARA
TAQGGEADSQPQFQGGAFATAALITKS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagcgactgcttattaccggcgccgccggcggcctgggccagctggcacgtgaa
aacctgggcgacctggcgcagcacctgcggctgagcgatatcagcccgctgcaggcgaca
tcgccacaggaagaaatcatgtgcggcgacctgagcgacgcggccttcgtcagccagctg
gtcgaaggctgcgatggcatactgcacctgggcggcgtctcggtcgagaatcacttcgag
gcgattctcagcgccaatattattggtgtgcataacctctacagtgccgcccagcaacac
ggccagccacgcatcctgtttgccagttccaaccacaccatcggtttccattcgccatca
acacgcttggacgccagctcggtgacgcgccccgacagctattacggcgtatccaagtgt
tttggggaagccgtggcgagcctgtattacgacaagctagggcaggaaaccgccatagtg
cgcattggctcctgttttcccgagccccaggatgttcgcatgctgagcacctggttcagc
ccggatgattttctggcgctgatcagacgcgtgttcaccatagacacactcggctgcccg
gtgatctacggcgtatccgccaacagggacgcctggtgggacaaccatgaaatcgatcat
ctcggctggaaaccaaaagacagttcagaggcataccgcgcccaagtggaagccagggcg
acggcgcaaggcggggaagcggacagccagccccagtttcagggcggagcctttgcaacg
gctgcgctaattacgaaaagctga

DBGET integrated database retrieval system