KEGG   Marinobacterium aestuarii: A8C75_20265Help
Entry
A8C75_20265       CDS       T04398                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
mars  Marinobacterium aestuarii
Pathway
mars00770  Pantothenate and CoA biosynthesis
mars01100  Metabolic pathways
Module
mars_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:mars00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    A8C75_20265
Enzymes [BR:mars01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     A8C75_20265
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     A8C75_20265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein
Motif
Other DBs
NCBI-ProteinID: ANG64576
UniProt: A0A1A9F2Y4
Position
4630977..4632182
Genome map
AA seq 401 aa AA seqDB search
MQRLTNRQIILGITGGIAAYKSAELTRLLKGAGADVRVVMTPAATEFITPLTLQALSGHA
VHQHLLDPEAEAGMGHIELAKWADLILIAPASADFIARLADGQGNDLLSTLCLATEAPIC
LAPAMNQAMWRNRHTQDNIARLHAGEISIFGPGSGEQACGDTGPGRMLEPTELAQLTAAQ
FDTGLLSGKTVFITAGPTREALDPVRYISNHSSGKMGYALAQAAVDAGARVKLISGPVNL
PAPPRMERVQVQSAQDMLAAAMDGIDSCDIFIAAAAVADYRPTAVSEHKLKKGAEEIMEL
RLVKNPDIVASVAALPRKPFTVGFAAETRDLLSYARSKLERKNLDLIVANDVSQPGIGFN
SDENAVTLVSRDAALVLPQTSKRQLASQLIRQIAELYNRAP
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgacttactaacagacaaatcattctgggcattaccggcggcattgccgcctac
aaaagtgccgagctcacgcgcctgctcaagggcgccggtgccgacgtgcgcgttgtcatg
acgcctgcggccactgagttcattaccccattgacgctgcaggcgctgtccggccatgcg
gtccaccagcatctgctggatcctgaagccgaagccggcatgggtcatatagagctggcc
aagtgggccgacctgatcctgattgcaccggccagtgccgatttcatcgcccgtctggcc
gatggtcagggcaatgacctgctcagcaccctctgtctggctaccgaggcaccgatctgt
ctggcgccggcgatgaaccaggccatgtggcgcaaccgtcatacccaggacaatattgcc
cgcctgcacgccggcgagatcagcatctttggtcccggcagtggcgaacaggcctgcggc
gacaccggccccggccggatgctggaacccacagagctggcccagctcaccgcagcccag
ttcgacaccggcctgctgagcggcaagaccgtctttattaccgcaggcccgacccgcgag
gcactggacccggtacgctacatttccaaccatagctccggcaagatgggctacgccctc
gcccaggcggcggtggatgcaggcgcgcgcgtcaagctgatcagcgggccggtcaacctg
ccagcacccccacgcatggagcgggtacaggtgcaaagcgcacaagacatgctggcggcg
gccatggacggaatcgatagctgcgacatctttatcgccgctgccgccgtggccgattac
cgccccacggcggtatccgagcacaagctgaagaagggtgccgaggagatcatggagctg
cggctggtaaagaatccggatatcgttgccagcgtcgccgccctgccccgcaaacccttt
actgtcggctttgccgccgaaactcgggatctgctcagctatgcccgcagcaagctggaa
cgcaagaatctggatctgatcgtcgccaacgacgtatcccagcccggcatcggctttaac
agcgacgaaaacgccgttaccctggtcagccgcgatgcggcactggtgctgccccaaact
tcgaaacgccagctggcgagccagctgatccgtcaaattgccgaactctataaccgagcc
ccatga

DBGET integrated database retrieval system