KEGG   Marinobacterium aestuarii: A8C75_22805Help
Entry
A8C75_22805       CDS       T04398                                 

Definition
(GenBank) ribonuclease P protein component
  KO
K03536  ribonuclease P protein component [EC:3.1.26.5]
Organism
mars  Marinobacterium aestuarii
Brite
KEGG Orthology (KO) [BR:mars00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mars03016]
    A8C75_22805
Enzymes [BR:mars01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     A8C75_22805
Transfer RNA biogenesis [BR:mars03016]
 Prokaryotic type
  5'processing factors
   Ribonucrease P
    A8C75_22805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuclease_P Complex1_LYR Rsm22
Motif
Other DBs
NCBI-ProteinID: ANG65030
UniProt: A0A1A9F4X6
Position
complement(5190469..5190843)
Genome map
AA seq 124 aa AA seqDB search
MAGFEYPRQLRILTGEGFQKVFDKVSLKVPDQPILILASFNELDHPRIGFVISKKNVRRA
VKRNRIRRIIRESFRLNQHNLPPVDLVILARKGLDELEPEEVHQLMKKCWSRLKHKAKKA
NPQR
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggccggattcgaatatcctcgccagctcaggattctgactggcgagggctttcagaag
gtttttgacaaagtctctctgaaagtccctgatcagcccatattgatacttgccagcttc
aacgagctcgatcacccccgtatcgggtttgtcatctccaaaaaaaatgtgcgtcgcgct
gtgaaacgcaatcgtattcgacgtatcattcgcgagtcatttcgccttaatcagcataat
cttcccccggttgatctcgtaattctggcacgcaaaggcctggatgagcttgaacccgaa
gaagtgcatcagcttatgaaaaaatgctggtcacggctgaaacacaaggcaaaaaaagct
aacccgcagagataa

DBGET integrated database retrieval system