KEGG   Maribacter sp. T28: BTR34_03045Help
Entry
BTR34_03045       CDS       T04597                                 

Definition
(GenBank) NAD(P)H-dependent oxidoreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
mart  Maribacter sp. T28
Pathway
mart00633  Nitrotoluene degradation
mart01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mart00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BTR34_03045
Enzymes [BR:mart01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     BTR34_03045
  1.-  
   1.-.-  
    1.-.-.-  
     BTR34_03045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase Cag12
Motif
Other DBs
NCBI-ProteinID: APQ16376
UniProt: A0A1B7Z6Y9
Position
693567..694169
Genome map
AA seq 200 aa AA seqDB search
MTFRRIAEERYTTKMYNASKKISDGEIEDLKHILKLSPSSINSQPWSFTFVSHKETKDKL
AEASFFNAPKIKNASHLVVFSVQDNLDEFERHVNENLAEGSINYYKHFVKGQPADKTINW
LTNQVYLSLGFFLAACAVMKIDSTPMEGIEPEKYKDILQIENHKVLFSVAIGYRDDEDNN
QPSVKSKSRLALKNVITSID
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgacttttagaagaatcgctgaagaacggtataccacaaaaatgtataatgcttcaaag
aaaatttcagatggggaaattgaagacttaaaacatatcttaaaactaagcccttcgtcc
attaacagccaaccttggtcatttacatttgtatcacataaagaaactaaggataaatta
gcagaggcatctttctttaatgctcctaaaattaaaaatgcaagtcaccttgttgttttt
agcgttcaagataatttagatgaatttgaacgtcatgtaaacgaaaatttagctgagggt
tcaataaattattataagcactttgttaaaggccaacctgccgacaagactattaattgg
cttacaaatcaagtttatttatctcttggatttttcttagcggcctgcgccgtaatgaaa
attgactcgacacctatggaaggtattgaaccagaaaaatataaagacattctacaaatt
gaaaaccataaagtacttttttctgtagcaattgggtatcgtgatgatgaagataacaat
cagcctagtgtaaaaagtaaatctcgattagcattaaaaaatgtaattacttcaattgac
tag

DBGET integrated database retrieval system