KEGG   Maribacter sp. T28: BTR34_04615Help
Entry
BTR34_04615       CDS       T04597                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
mart  Maribacter sp. T28
Pathway
mart00051  Fructose and mannose metabolism
mart00520  Amino sugar and nucleotide sugar metabolism
mart01100  Metabolic pathways
mart01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mart00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BTR34_04615
   00520 Amino sugar and nucleotide sugar metabolism
    BTR34_04615
Enzymes [BR:mart01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     BTR34_04615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 MannoseP_isomer
Motif
Other DBs
NCBI-ProteinID: APQ16662
UniProt: A0A1B7ZDZ7
Position
complement(1062694..1063773)
Genome map
AA seq 359 aa AA seqDB search
MNKNYYAVLMAGGVGSRFWPISTSENPKQFHDMLGTGSTLIQKTFQRLNKFVPKENILIL
TNERYNDLVLEQLPMVKQEQVVLEPAMRNTAPCILYAALKIKKMNEDAVMIVAPSDHWIE
DEDAFAKDVTACFKKCETEDVLCTLGIKPSFPNTGFGYIEYNKTDTASIKKVNQFREKPD
YETAKDFLAQGNFLWNAGIFMWSAKTIVDAFQKFQPKQYALFNSGLICYNTNEEKKFISE
NYSKAENISIDYAILENSETIYVKEATFDWNDLGTWGSLYDKLDKDDNNNAIVNGKVLTQ
DAGGNMIRSKAGKVIVVDGLNDYIIVDKEEVLLIYPKAKEQDIKQVLNKVKDTFGDEFA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaattattatgccgttttaatggctggtggagtagggtctagattttggcca
attagtacaagtgaaaacccaaaacagtttcatgatatgttgggcacggggtcaacactt
atacagaaaacttttcagagattgaataaatttgtgcctaaagaaaatattctcattctt
accaatgagcgctataatgatctggtcttggaacaacttccgatggtgaagcaagagcaa
gttgtattggaacctgcaatgagaaatacggcaccttgtatattatacgctgcattgaaa
attaagaaaatgaatgaagatgcagtaatgattgttgctcctagtgatcattggattgaa
gacgaagatgcttttgcaaaagatgttacggcgtgttttaaaaagtgcgaaacagaagat
gttttgtgtacgttaggtattaagccttcattccctaatacaggctttgggtatatagag
tataataaaactgatactgcatcaattaaaaaagtaaatcagtttagagaaaagccagac
tacgaaactgcgaaagattttcttgcgcaaggtaattttttgtggaatgcagggattttt
atgtggagcgcaaaaactatagttgatgcatttcaaaaattccaaccaaagcagtatgct
cttttcaacagtggtctaatttgttataatacaaatgaagaaaagaaatttatctctgag
aactattcaaaggcggagaatatttctattgattatgctatattagaaaattctgaaact
atttatgttaaagaagctacttttgattggaatgatctaggtacttggggttcattatac
gataagttagataaagatgataataacaatgcaattgtaaatgggaaagtattaacccaa
gatgctggaggtaatatgattaggtctaaagcgggtaaagtaattgttgtagatggactt
aatgattatatcattgttgataaagaagaagtacttttaatctatcctaaagcaaaagaa
caagatattaaacaagttttaaataaggtaaaagatacctttggtgatgaattcgcttaa

DBGET integrated database retrieval system