KEGG   Maribacter sp. T28: BTR34_08075Help
Entry
BTR34_08075       CDS       T04597                                 

Definition
(GenBank) glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
mart  Maribacter sp. T28
Pathway
mart00511  Other glycan degradation
mart00600  Sphingolipid metabolism
mart01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mart00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    BTR34_08075
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BTR34_08075
Enzymes [BR:mart01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BTR34_08075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59 Glyco_hydr_30_2
Motif
Other DBs
NCBI-ProteinID: APQ17286
UniProt: A0A1B7Z4B1
Position
complement(1873617..1875068)
Genome map
AA seq 483 aa AA seqDB search
MKYDHVNFCALLALFFLVANTACSTKDKKTIEENSAEAKLYITTLDKSQLVQEHAVNMDS
LLKAEMEVAVDIKTTYQEIDGFGFTLTGGSALHMSQMSASARAALIQELFGKEANAIGVS
YLRLSIGGSDLDEYPWSYNDLPKGLTDESLSKFSLAYDTLYLIPVLKEILDVSPNLKLMG
SPWSPPSWMKDNQDTRGGSLLPKYQNVYANYLAKYIQEMSKHGITIDALTIQNEPLHPGN
NPSLLMLAEQQADFIKNDLGPTFKRLGIKTKIVIYDHNADRPDYPISILNDADAAQYIDG
SAFHLYGGKIEALSEVHEAHPTKNIYFTEQWVGAPGNFEGDVAWHNETLIIGATRNWSKT
VLEWNLAADENEDPHTDRGGCDRCLGALTITGDSVVRNPGYYIIGQASKFVPPGSRRIAS
NTYDNLPNVAFITPASEVVVILQNKETVDKTIEIKVNENSVFIEIPAKSIGSLVYKNPSE
IKD
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacgaccatgtcaatttttgtgcccttttggcgctatttttcttagtcgctaat
acggcctgttctaccaaggataaaaaaacaattgaagaaaatagtgcagaagctaaacta
tatattaccactttagacaaatcgcaattagtacaagaacatgctgtaaacatggatagt
ttgctaaaggcagagatggaggttgcggtagatattaagactacttaccaagaaatagat
ggctttgggtttacactaacgggaggcagtgcattacacatgagccaaatgtccgcatcg
gcaagagcggcgttaattcaagaattatttggtaaagaagccaatgccataggagttagt
tatttacggttaagtataggtggctctgatctagatgaatatccttggtcgtataatgat
ttgcccaaaggtttgaccgatgaatctttgtcaaaattttctttggcgtatgatacgttg
tatttgataccagtgttaaaggagattttagatgtttcaccgaatctaaaacttatgggc
tccccgtggtcacctcctagttggatgaaagacaaccaagatacgcgcggcggtagttta
ttaccaaaatatcaaaatgtctatgctaattatttggcaaaatatatacaagaaatgagt
aagcatggtattaccatagatgctttgacgatacagaacgaacccttgcacccaggcaat
aatcctagccttttaatgctggccgagcagcaggccgattttataaaaaatgatttaggg
ccaacctttaaaagattaggaatcaaaacaaaaattgttatttatgaccataatgcagac
cgccccgattatcctatttctattttaaatgatgcggatgctgcgcaatatatagatggt
tcggcttttcatttatacgggggcaagatagaagccttgtccgaggttcacgaggcacac
cccactaaaaacatctattttacggagcaatgggttggcgcacctggtaattttgaaggc
gatgttgcctggcataacgaaacattaattattggcgctaccagaaactggagtaaaacc
gtattagaatggaatttagcggcagatgaaaatgaggatccgcatacagaccgtggtggg
tgcgaccgctgtttaggggcattgacgataactggggattcagtagttcgtaatccgggg
tattatataattgggcaagcatctaaatttgtgccaccggggtctaggcgaattgcgtca
aatacatatgataacctccctaatgtggcgtttataactccggcaagcgaagtggttgta
attctacaaaataaggaaacggttgataagaccattgagataaaagtaaatgaaaattcc
gtttttatagaaataccagcaaaatctataggcagtttggtctataaaaatccaagtgaa
attaaagattaa

DBGET integrated database retrieval system