KEGG   Mahella australiensis: Mahau_0836Help
Entry
Mahau_0836        CDS       T01494                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mas  Mahella australiensis
Pathway
mas00010  Glycolysis / Gluconeogenesis
mas00052  Galactose metabolism
mas00500  Starch and sucrose metabolism
mas00520  Amino sugar and nucleotide sugar metabolism
mas00521  Streptomycin biosynthesis
mas01100  Metabolic pathways
mas01110  Biosynthesis of secondary metabolites
mas01120  Microbial metabolism in diverse environments
mas01130  Biosynthesis of antibiotics
mas01200  Carbon metabolism
Module
mas_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mas00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mahau_0836
   00052 Galactose metabolism
    Mahau_0836
   00500 Starch and sucrose metabolism
    Mahau_0836
   00520 Amino sugar and nucleotide sugar metabolism
    Mahau_0836
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mahau_0836
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Mahau_0836
Enzymes [BR:mas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mahau_0836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Hydant_A_N FGGY_N
Motif
Other DBs
NCBI-ProteinID: AEE96034
UniProt: F4A1K0
Position
878078..879043
Genome map
AA seq 321 aa AA seqDB search
MNEKYIAGIDLGGTTIQTVLTDENYNIVTKYKSDTLAKEGPDAVIERMMDAIDHVLEESK
LSKEDLLGIGLGIPGLMDIEKGISLFAGNLSWENIQVVQPFKDRFNVPVYMDNDVRVNAL
GEWYFGAGRGVKNMVLITLGTGVGAGIIIDGKMLRGPQSAAGEVGHMIIVEDGPACTCGS
RGCLEVFASATGMMRRCKELMLENRDSLLWQMCDGDIDKVRTHMIDKAHDQGDKVGRQVM
AETAYYLGIGLTNVVNIFNPELVVIGGGVSKAGERLLGPARDFVNKRAMVVQRQHYKLVA
AQMLDEAGMLGACTLAKENLP
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaaagtacatagctggtatagacttgggaggtaccactatacaaacggtattg
accgatgaaaactataatattgtaacaaaatataagagcgatactttggctaaagaagga
ccggatgctgtcatagaacgtatgatggatgccatagaccatgtgttggaagaatccaag
ctgagtaaggaagacctattgggtataggtctgggtataccgggtcttatggatatagaa
aaaggaatatcattatttgccggcaatctcagctgggagaatatacaggtagtgcaacct
tttaaagacagattcaatgtgcctgtatatatggacaatgatgtaagagtaaatgcgctt
ggtgaatggtattttggagctgggcgtggcgtaaagaacatggtattgattacccttgga
accggtgtgggagcaggtataataatagatggcaaaatgctacgcggtccacagtcagca
gcaggcgaggtaggtcatatgatcatagtagaggatggccctgcctgtacatgtggtagc
cgtgggtgtctggaggtatttgcgtcggctaccgggatgatgcggcgctgcaaagagttg
atgttggagaatcgcgatagcctattgtggcagatgtgtgacggtgatatagataaagtg
agaacacatatgatagataaagcccatgaccaaggcgacaaagtagggcgacaggtaatg
gccgaaacagcctattatcttggtataggactgaccaatgtagtgaatatattcaatcct
gagttggtggtcataggaggaggagtttccaaagctggcgaacgattgctaggacccgcc
agagactttgtgaataagcgggcaatggtggtacagcggcagcattacaagcttgtggcg
gcgcagatgctggatgaagcaggcatgttgggtgcatgtacattggcgaaagaaaattta
ccataa

DBGET integrated database retrieval system