KEGG   Massilia violaceinigra: CR152_18380Help
Entry
CR152_18380       CDS       T05157                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mass  Massilia violaceinigra
Pathway
mass00450  Selenocompound metabolism
mass00970  Aminoacyl-tRNA biosynthesis
mass01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mass00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CR152_18380
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CR152_18380
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mass01007]
    CR152_18380
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mass03016]
    CR152_18380
Enzymes [BR:mass01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CR152_18380
Amino acid related enzymes [BR:mass01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CR152_18380
Transfer RNA biogenesis [BR:mass03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CR152_18380
 Prokaryotic type
   Other AARSs
    CR152_18380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind Anticodon_1 tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ATQ76285
UniProt: A0A2D2DMS0
Position
complement(4118821..4120953)
Genome map
AA seq 710 aa AA seqDB search
MTRKLFVTTALPYANGAFHIGHMMEYIQADIWVRFQRMQRDADGQREVHFVCADDTHGTP
IMIAAEKEGITPQEFVAKIAADRPQYLDGFHIAFDNWYSTDSPENVELSQGIYRKLRDTG
LIVTKTVDRFFDPVKGMFLADRNIKGECPKCGAKDQYGDNCEVCGAAYQPTELVNPFSVF
TGSTPILKPSEQYFFALSDPRCYTFLKEWLNTPGRLQSEMVNKVSEWLGDAGEKLADWDI
SRDAPYFGIPIPDAPGKFFYVWLDAPVGYLASLKNYCSKKGMDFDALLNDPDTEQVHFIG
KDIVSFHLLFWPAMLNFAGHPVIDKLKVNVHGHLTLNGEKMAKSRGTGISPLRYLDLKMN
PEWLRYYIAFKLNSKVEDLDFNGEDFIARVNSDLIGKYVNIASRCAGFIAKNFEGKLTST
LSPHAQQWIGRALTVDGNERQASIAANFENREFGKALREIMEIADITNQYVDENKPWILA
KDPEKTAHLHDVCTTALILFRQITIMLSPVLPQIAAKVAEFLRDDALTWSDTTGAAVYET
MLGREIGAYSHLMTRIDAKMVEALIDKPAVVAVPAPAPAVPAPALDAPERGDIEELAPEI
KIDDFTKIDLRIAKIVNCEQVDGSDKLLRLTLDVGEGRLRNVFSGIKSAYTPEQLIGKLT
VLVANLAPRKMKFGVSEGMVLCASAADEKADPGLYVLEPWPGAQPGMRIR
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcaagctgttcgtcaccaccgccctgccttacgccaacggcgcctttcacatc
ggccacatgatggaatacatccaggctgatatctgggtccgttttcagcgaatgcaacgc
gatgcggacggccagcgcgaggtccatttcgtctgcgccgacgatacccacggcacgccg
atcatgatcgcggccgaaaaggaaggcatcacgccccaggaattcgtggccaagatcgcg
gccgaccgtccgcaatacctggacggcttccacattgccttcgataactggtactcgacc
gattcacccgagaacgtggagctgtcgcaaggcatctatcgcaagctgcgcgataccggc
ctgatcgtcacaaagacggtcgaccgcttcttcgacccggtcaagggcatgttcctggcc
gaccgcaacatcaagggcgaatgcccgaaatgcggcgccaaggaccagtacggcgacaat
tgcgaagtctgcggcgcggcctaccagccgaccgaactggtgaacccgttttcggtgttc
accggctcgactccgattctgaagccatcggaacagtatttcttcgccctgtcggacccg
cgctgctacaccttcctcaaggaatggctgaacacgcctggccgtttgcagtcggaaatg
gtgaacaaggtctccgagtggctcggcgacgccggcgaaaaactggccgactgggatatt
tcgcgcgatgcgccctacttcggcatcccgattcctgatgcgccgggcaagtttttctat
gtctggctggacgcgccggtcggctatctggcgagcctgaaaaattactgcagcaaaaaa
gggatggatttcgatgccctgctgaacgacccggacaccgagcaagtccacttcatcggc
aaggatattgtgtccttccacctgctgttctggccagccatgctcaatttcgccggccac
ccggtgatcgacaagctgaaagtcaatgtgcacggccacctgaccctgaacggtgaaaag
atggccaagtcgcgcggcaccggcatttcgccgctgcgctacctcgacctgaagatgaat
ccggaatggctgcgctactacatcgccttcaagctgaactcgaaggtcgaagacctcgac
ttcaacggcgaggacttcattgcccgcgtgaatagcgacctgatcggcaaatacgtcaac
atcgccagccgctgcgccggtttcatcgccaagaatttcgagggcaagctgacctccacc
ctgtcgcctcacgcgcaacagtggatcggccgcgcgctgacggtcgacggcaatgaacgc
caggccagcatcgccgccaacttcgagaaccgcgagttcggcaaggcgctgcgcgaaatc
atggaaatcgccgacatcaccaaccagtatgtcgatgaaaacaagccgtggattttggcc
aaggacccggaaaaaaccgcgcacctgcacgatgtctgcaccacagcgctgatcttgttc
cgccagatcaccatcatgctctcgccggtgctgccgcaaattgccgccaaggtcgccgaa
ttcctgcgcgacgatgcgttgacctggagcgatacgacgggcgccgccgtgtacgaaacc
atgctcggccgcgaaatcggcgcctacagccacctgatgacccgcatcgacgccaagatg
gtcgaagcgctgatcgacaagccggccgtggtggccgtgcctgcaccggcgccagccgtc
cccgcaccggccctggacgcgcccgaacgcggcgatatcgaagaactggcgccggaaatc
aagatcgacgacttcaccaagatcgacctgcgcatcgccaagatcgtcaactgcgaacag
gtggacggctccgacaagctgctgcgcctgaccctggacgtgggcgaaggccgtctgcgc
aacgtgttctccggcatcaagtcggcctacacgcccgagcagctgatcggcaaactgacc
gtgctggtggccaacctggcgccgcgcaagatgaaattcggcgtctccgaaggcatggtt
ctgtgcgcctcggccgccgacgaaaaagccgatcccggcttatacgtgctggaaccatgg
ccgggcgcgcagccgggcatgcgtattcgctaa

DBGET integrated database retrieval system