KEGG   Massilia violaceinigra: CR152_31095Help
Entry
CR152_31095       CDS       T05157                                 

Gene name
acnD
Definition
(GenBank) Fe/S-dependent 2-methylisocitrate dehydratase AcnD
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
mass  Massilia violaceinigra
Pathway
mass00640  Propanoate metabolism
mass01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mass00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CR152_31095 (acnD)
Enzymes [BR:mass01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     CR152_31095 (acnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: ATQ78468
UniProt: A0A2D2DU19
Position
complement(7229614..7232211)
Genome map
AA seq 865 aa AA seqDB search
MNTNHRKNLPGTKLDFFDARAAVDAIEPGAYYKLPYTSRVLAENLVRRCDPATLNASLGQ
LIERKRDLDFPWFPARVVCHDILGQTALVDLAGLRDAIALQGGDPALVNPVVPTQLVVDH
SLAVECGGFDPDAFDKNRAIEDRRNEDRFDFINWTKKAFKNVDVIPPGNGILHQINLERM
SPVVQVQGGVAFPDTLVGTDSHTPMVDALGVIAIGVGGLEAESVMLGRASWMRLPDIIGV
ELTGKPQPGITATDTVLALTEFLRQQKVVSSYLEFYGEGAAHLTLGDRATISNMAPEYGS
TAAMFYIDEQTIKYLKLTGRDDELVKLVELYAKHTGLWGESLKSAEYERVLSFDLSSVVR
TIAGPSNPHNRVPTSELAARGISGVVENEPGLMPDGAVIIAAITSCTNTNNPRNMIAAGL
IARNANKLGLTRKPWVKSSLAPGSKAVTLYLEDAGLMRELETLGFGVVAYACTTCNGMSG
ALDPVIQKEVVERDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTIRFDIE
KDVLGIGADGKPVTLKDIWPSDEEIDALVASSVKPAHFHKVYIPMFAKQEDDGIKVSPLY
DWRPNTTYIRRPPYWEGALAGARTLAGMRPLAVLGDNITTDHLSPSNAIMLDSAAGEYLA
KMGLPEEDFNSYATHRGDHLTAQRATFANPTLKNEMVVVDGKVKAGSLARIEPEGTVTRM
WEAIQTYMERKQPLIIIAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNLVGMG
VLPLEFEPGVNRITLAIDGSETFSVLGDRTPRATLTLVITHVSGDTVEVPVICRLDTAEE
VAIYEAGGVLQRFAQDFLESTVKEA
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgaatcaccgcaagaacctgccgggcaccaaactcgatttcttcgacgcgcgc
gccgcggtcgacgccatcgagcctggcgcttactacaagctgccgtacacctcgcgcgtg
ctggccgaaaacctggtgcgccgttgcgaccctgcgaccttgaacgcctcgctgggtcaa
ctgatcgagcgcaagcgcgaccttgacttcccgtggtttccggcgcgcgtggtttgccac
gacatcctcggccagaccgcgctggtcgacttggccggcctgcgcgacgcgattgccctg
cagggcggtgatccggccctggtcaacccggtggtgccgacccagctggtggtcgaccac
tcgctggcagtcgaatgcggcgggttcgatcccgacgcgttcgacaagaaccgtgccatc
gaggatcgccgcaatgaagaccgtttcgacttcatcaactggaccaagaaagcgttcaag
aacgttgacgtcatcccgccgggtaacggcatcctgcatcagattaatctggagcgcatg
tcgccggtggtccaggtgcagggcggcgtggcctttccggacaccctggtcggcaccgac
tcgcacaccccgatggtcgacgcgctcggcgtgatcgcgatcggcgttggcggcctggaa
gccgaaagcgtgatgctgggccgcgcctcgtggatgcgcctgccggacatcatcggcgtc
gaactgaccggcaaaccgcagccgggcatcaccgccaccgacacggtgctggcgctgacc
gaattcctgcgccaacagaaggtcgtgtcgtcctatctcgaattctacggcgaaggcgct
gcacacctgaccctgggcgaccgcgcgacgatctccaacatggcgccggagtatgggtcg
actgccgcgatgttctacatcgacgagcagaccatcaagtacctcaagctcaccggccgc
gacgacgaactggtcaagctggtcgagctgtatgcgaagcacaccggtttgtggggcgag
tcgctcaagagcgccgagtacgagcgtgtactgagcttcgacctgtcgtcggtggtgcgc
accatcgccggcccgtccaatccgcacaaccgcgtgccgacgtcggaactggccgcacgc
ggcatcagcggcgtggtcgaaaacgaaccgggcctgatgcccgacggcgccgtcatcatc
gcggccattaccagctgcaccaacaccaacaacccgcgcaacatgatcgccgccggcctg
atcgcgcgtaacgccaacaagcttggcctgacgcgcaagccctgggtcaagagttcgctg
gcgccaggctccaaggccgtcaccctgtacctggaagacgctggcctgatgcgcgaactc
gaaacgctcggcttcggtgtcgtcgcttacgcctgcaccacctgcaacggcatgtccggg
gcgctcgatcctgtgattcaaaaggaagtggtggagcgcgacctgtacgcgaccgccgtc
ctgtcgggcaaccgcaacttcgacgggcgcatccacccgtacgcgaaacaggcattcctg
gcgtcgccgccgctggtggtggcctacgcgatcgccggcacgatccgattcgacatcgag
aaggacgtgctgggcatcggtgccgacggcaaaccggtcacgctcaaggatatctggccg
agcgacgaggagatcgacgcactggtggcgtccagcgtcaagccggcgcacttccacaag
gtctacattccgatgttcgccaagcaggaagacgacggcatcaaggtcagcccgctgtac
gactggcgtccgaataccacctacatccgccgtccgccgtactgggaaggcgcgctggcc
ggtgcgcgcacgctggccggcatgcgtccgctcgcggtcctgggcgacaacatcaccacc
gaccacctgtcgccgtcgaacgcgatcatgctcgattccgcagccggcgaatacctggcg
aaaatgggcctgccggaggaagacttcaactcctacgccacccatcgcggcgaccacctg
accgcgcaacgcgccaccttcgccaatccgaccctgaaaaacgaaatggtcgtggtggac
ggtaaggtcaaggcaggctcgctggcccgcatcgaaccggaaggcacggtcacccgcatg
tgggaagcgatccagacctacatggagcgcaagcagccgctgatcatcattgccggcgcc
gactacggccagggttcctcgcgcgactgggccgccaagggcgtgcgcctggccggcgtg
gaagccatcgtcgcagaaggcttcgagcgcatccaccgcaccaacctggtgggcatgggc
gtgctgccgctggagttcgaacctggcgtgaaccgcatcaccctggcgatcgacggcagc
gaaaccttcagcgtgctgggcgatcgtaccccgcgcgccacgctcacactggtgatcacg
cacgtctccggcgacacggtcgaagtgccggtcatctgccgcctggacaccgccgaagaa
gtggcgatctacgaagccggcggcgtgctgcagcgcttcgcccaggacttcctcgaatcg
accgtgaaggaagcatga

DBGET integrated database retrieval system