KEGG   Massilia sp. WG5: AM586_02720Help
Entry
AM586_02720       CDS       T04122                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
masw  Massilia sp. WG5
Pathway
masw03010  Ribosome
Brite
KEGG Orthology (KO) [BR:masw00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AM586_02720
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:masw03011]
    AM586_02720
Ribosome [BR:masw03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AM586_02720
  Bacteria
    AM586_02720
  Archaea
    AM586_02720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ALK95362
Position
3782140..3782469
Genome map
AA seq 109 aa AA seqDB search
METKAILKGVRLSEQKGRLVADLIRGKKVDAALNILQFSPKKGATIIKKVLESAIANAEH
NDGADIDELKVVQIYVEKGPILKRFTARAKGRGDRISKQSCHVYVTVGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaaactaaagcaatcctcaaaggcgttcgcctgtccgagcagaagggccgcctggtt
gcggacctgatccgcggcaagaaggtcgacgccgcgctgaacatcctgcagttcagcccg
aaaaaaggcgccaccatcatcaagaaggtgctggagtccgcaatcgcgaacgccgagcac
aacgatggtgccgacatcgacgaactgaaggtcgttcagatctatgtcgaaaagggtccg
atcctgaagcgctttacggctcgcgccaaaggccgcggtgatcgcatttcgaaacaatcc
tgtcacgtctacgtgactgtcggtaactaa

DBGET integrated database retrieval system